KEGG   Mus musculus (mouse): 224792
Entry
224792            CDS       T01002                                 

Symbol
Adgrf5, 8430401C09Rik, 9330185D23, AI528491, Gpr1, Gpr116, mKIAA0758
Name
(RefSeq) adhesion G protein-coupled receptor F5
  KO
K08458  adhesion G-protein coupled receptor F5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    224792 (Adgrf5)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    224792 (Adgrf5)
Peptidases and inhibitors [BR:mmu01002]
 Mixed peptidases
  Family P2
   224792 (Adgrf5)
G protein-coupled receptors [BR:mmu04030]
 Adhesion receptor family
  Others
   224792 (Adgrf5)
SSDB
Motif
Pfam: 7tm_2 GPS Ig_3 ig I-set SEA GAIN Ig_2 V-set DUF5874 DUF2976
Other DBs
NCBI-GeneID: 224792
NCBI-ProteinID: NP_001074647
MGI: 2182928
Ensembl: ENSMUSG00000056492
UniProt: G5E8Q8
Position
17; 17 B3
AA seq 1348 aa
MRSPRTFTFYFLLLVICSSEAALSTPTEPIVQPSILQEHELAGEELLRPKRAAAAGDRVA
EEYMVDIEISFENVSFLESIRAHLNNLSFPIRGTEADILNIAMTTVCTPAGNDLLCFCEK
GYQWSEERCLHSLTCQDYDSALPGGYCSCLKGLPPQGPFCQLPEAFITLKLKVRLNIGFQ
EDLKNTSSALYRSYKTDLERAFRAGYRTLPGFRSVTVTQFTKGSVVVNYVVRVTSAPLPG
SIHKANEQVIQNLNHTYKMDYNSFQGTPSNETKFTVIPEFIFEGDNVTLECETEFVTSNT
SWYYGEKRSDIQNSDKYSIHTTVINNISLITRLTIYNFTQHDAGMYGCNVTLDIFEYGTV
RKLDVTPIRILAKEERKVVCDNHPISLNCCSENIANWSSIEWKQEGKISILGNPESDLES
SCSTYTLKADGTQCPSGSSGTTVIYTCEFVSAYGARGSKNIAVTFTSVANLTITRDPISV
SEGQSFSITCLSDVSSFDEVYWNTSAGIKIHPRFYTMRRYQDGAESVLMVKTSTREWNGT
YHCIFRYKNSYSIATKDVTVHPLPLVSDIMMDPLEASGLCTSSHQFKCCVEEDAGEEYAV
TFHVDSSSFPAEREVIGKQACYTYSLPANLPRCPKDIAVFCHFTNAANSSVRSPSMKLKL
IPRENVTCQDPIIGIGDPGKVIQKLCQFSGVYGSPGQAIGGTVTYKCVGTQWKEESRACI
SAPINGLLQVAKALIKSPTQDQKLPTYLRDLSVSAGKEEQDIRSSPGSLGAIISILDLLS
TVPTQVNSEMMRDILATINVILDKSALNSWEKLLQQQSNQSSQFLHSVERFSQALQLGDS
TPPFLAHPNVQMKSMVIKRGHPQIYQQQFIFKDSDLWGDVAIDECQLGNLQPDSSIVTVA
FPTLKAILAQDVQRKTSSNSLVMTTTVSHNIVKPFRISMTFKNNHRSGGKPQCVFWNFSL
ANNTGGWDSSGCSVEDDGRDNRDRVFCKCNHLTSFSILMSPDSPDPGSLLKILLDIISYI
GLGFSIVSLAACLVVEAMVWKSVTKNRTSYMRHICIVNIAFCLLIADIWFIVAGAIHDGR
YPLNETACVAATFFIHFFYLSVFFWMLTLGLMLFYRLIFILHDASKSTQKAIAFSLGYGC
PLIISSITVGVTQPQEVYMRKNACWLNWEDTRALLAFAIPALIIVVVNVSITVVVITKIL
RPSIGDKPGKQEKSSLFQISKSIGVLTPLLGLTWGFGLATVIQGSNAVFHIIFTLLNAFQ
GLFILLFGCLWDQKVQEALLHKFSLSRWSSQHSKSTSIGSSTPVFSMSSPISRRFNNLFG
KTGTYNVSTPETTSSSLENSSSAYSLLN
NT seq 4047 nt   +upstreamnt  +downstreamnt
atgagatcgccaaggaccttcacgttctacttcctgcttcttgtgatttgttcttcagaa
gctgcgctgagcacaccaacagagcccattgttcaaccttcaattctccaagaacatgag
ctagccggggaagagctactgaggccaaaaagagcagctgcagcgggtgatcgcgtggcg
gaagaatacatggtggatattgagatcagctttgaaaatgtctccttcctggagtccatc
agagctcacttgaacaacctcagttttccaattcgagggaccgaagctgacattttgaac
atagcaatgactacagtctgcactcctgctggaaatgacctcttgtgcttctgtgagaaa
ggctaccagtggtctgaggaaaggtgtctccactctctcacttgtcaagactatgacagt
gccctgccaggcggctactgcagttgtctgaaaggacttcctccccagggacctttctgc
cagctcccagaagcattcattaccttaaaactcaaagtcagactgaacataggatttcaa
gaagacctaaagaacacgtcttctgccctctataggtcctacaagactgatctggaaaga
gcgttccgagcgggttacagaactttaccaggattcagatcggtgactgtgacacagttc
accaagggcagcgtggttgtgaactacgtagtccgggttacatcggcaccactgcctgga
tctattcataaagccaatgaacaagtcatacagaacctcaaccatacttacaaaatggac
tacaactccttccagggaaccccgagcaatgagacgaaattcactgtcataccagaattc
atctttgagggagacaatgtgactctggagtgtgaaactgagttcgtgacctccaacacg
tcttggtactatggagaaaaacgctctgacatccagaacagcgacaaatactccattcac
accactgtcatcaacaatataagcctgatcacccgccttaccatttacaacttcacacag
catgatgcgggcatgtatggttgcaatgtgacattggatatttttgaatatggaacagtc
agaaaattagatgtcactcccatccggattttggccaaggaggagagaaaggtggtgtgt
gacaaccatcctatatcgctgaactgctgcagcgagaatattgcaaactggagcagtatt
gaatggaaacaggaagggaagataagcattctagggaacccagaatcagacctagagtct
agctgcagcacttacacgctcaaggcagatggaacccagtgtcccagtgggtcttctgga
acaacagtcatctacacatgcgagttcgtcagtgcctatggagccagaggcagtaagaac
atagctgtgaccttcacctctgtagccaacctaacaataacccgggacccaatttctgtt
tctgagggacaaagcttttctataacctgcctcagcgatgtgagtagctttgatgaggtg
tactggaacacctcagctggtattaaaatccacccaaggttttataccatgaggaggtat
caggatggagcagagtcggtgctgatggtgaagacctccacccgagagtggaacggaacc
taccactgcatatttagatataagaattcatacagcattgccaccaaagatgtcaccgtt
cacccgctgcctctggtgtcagacatcatgatggatcctttggaagccagtggtctgtgt
accagttcccatcaattcaaatgctgcgtagaagaggatgcaggggaagagtacgctgtg
actttccacgtggactcctcatcctttcccgctgaaagagaagttatcggcaagcaagca
tgctacacatacagtctcccagcgaacttacctcgatgtcccaaagacatcgcagtgttc
tgccacttcaccaatgcagccaacagctcagtccggagcccatctatgaagctcaaactt
attccaagggagaatgtcacatgccaggatcccatcattggcattggggatcctgggaaa
gtcattcagaagctgtgccagttctcaggtgtttacggaagccctggacaggccatcggc
gggactgtcacttacaaatgtgtgggcacccagtggaaggaggagtcaagggcctgcatc
tcagctccaatcaatggtttgctccaggtggccaaggctttgatcaagagccccacccag
gaccagaagctccctacatacctgagggacctttctgttagtgctgggaaggaagaacag
gacatccgctcatctccaggaagcctgggagccatcatcagcatccttgacttgctctca
acggttcccacccaagtgaattcagaaatgatgagagacatacttgctaccattaacgtc
atcttagacaagtctgccttgaactcctgggagaagttgctacagcaacagagcaatcag
agttctcagttcctgcactccgtggaaaggttttcccaagccctccagctgggagacagc
actcctccattcctcgcccaccctaacgttcagatgaagagcatggtgataaaacgtggc
cacccccaaatctaccaacagcagtttatcttcaaagactctgacctgtggggtgatgta
gccattgatgagtgtcagctgggaaacttgcagcctgattcatcgatcgttactgtggct
ttcccaactctcaaagccatccttgcccaggatgtacagagaaagacatcctccaacagc
ttagtaatgacaaccactgtcagccataacattgtcaagccatttaggatttctatgact
tttaagaacaaccatcgttcgggtggcaagccacagtgtgtcttctggaacttcagtctt
gccaacaatacagggggctgggacagcagtgggtgctctgtggaagatgatggtagggac
aatagggacagagtcttctgcaagtgtaaccacctgacgtcattctccatcctcatgtcc
ccagactccccagatccagggtctcttttaaaaatacttctggatatcatttcttacatc
gggttggggttttccatagtcagcttagctgcctgtctagttgtggaagccatggtgtgg
aaatctgtgaccaagaaccgaacttcctatatgcgccacatctgcatagtcaacattgcc
ttttgccttctgattgctgacatctggttcattgtggctggtgctatccacgacggtcgc
tacccactcaacgaaacagcctgtgtggccgccacattcttcattcacttcttctacctc
agtgtcttcttctggatgctaactctaggcctcatgctcttctaccggctgattttcatt
ctacacgatgcaagcaagtccactcagaaagccatcgcattttctctaggctatggctgt
cccctcattatctcctctatcacagtgggggttacgcagccacaggaagtctacatgagg
aagaacgcgtgttggctcaactgggaggacaccagagcactgctggcttttgccatcccc
gcgttgattattgtggtggtaaatgtgagcatcacagttgtggtcatcaccaagatcctg
aggccctccattggggacaagccaggcaagcaagagaagagcagcctattccagatcagc
aagagtatcggggtcctcacaccactcttggggctcacttggggtttcggtcttgccaca
gtgatccagggaagcaatgctgtgttccacatcatatttactctcctcaatgccttccag
gggctcttcattttgctctttggctgcctctgggatcagaaggtgcaggaagctttgctg
cataagttttcattgtcaaggtggtcttctcaacactcaaagtcaacatccataggttcg
tcaacacccgtgttttcaatgagttctccaatatcccgaagatttaataatctttttggt
aaaacaggaacatataacgtttccaccccagagacaaccagttcatccctggaaaattcc
tctagtgcttactcactgctcaactag

DBGET integrated database retrieval system