KEGG   Mus musculus (mouse): 224796
Entry
224796            CDS       T01002                                 

Gene name
Clic5, 5730531E12Rik, B330005L24, Gm322, jbg, nmf31, nmf318
Definition
(RefSeq) chloride intracellular channel 5
  KO
K05025  chloride intracellular channel protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    224796 (Clic5)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   224796 (Clic5)
SSDB
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_5
Other DBs
NCBI-GeneID: 224796
NCBI-ProteinID: NP_766209
MGI: 1917912
Ensembl: ENSMUSG00000023959
UniProt: Q8BXK9
Position
17; 17 B3
AA seq 251 aa
MTDSATTNGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKP
ADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS
KFSAYIKNTKQQNNAALERGLTKALRKLDDYLNSPLPEEIDTNTHGDEKGSQRKFLDGDE
LTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELA
YADVARRLSRS
NT seq 756 nt   +upstreamnt  +downstreamnt
atgacggactcagcgacaactaatggggacgacagggaccccgagatcgagctcttcgtg
aaggctgggatcgacggggaaagcattggcaactgtcccttctctcagcgtctcttcatg
atcctctggctgaaaggagtcgtgttcaatgtcaccaccgtggatctgaaaagaaagcca
gccgatctacacaacctggctcctggcacgcacccgcccttcctgaccttcaatggggat
gtgaagacagatgtcaacaagattgaagagttcctggaggagaccctaacccccgagaag
taccccaaactggctgcaaaacaccgggaatctaacaccgcgggcatcgacatcttctcc
aagttctcagcctacatcaaaaacaccaaacaacagaacaatgctgcccttgagagaggc
ttgacaaaggcgctgaggaagctggatgactacctaaacagccctctgccagaggagatt
gacaccaacacccacggggacgagaaggggtcccagcgcaagttcctggatggggatgag
ctgaccctggccgactgcaatctgctgcccaagctgcatgtggtcaagattgtggctaag
aagtaccgaaactatgacatcccagctgagatgacaggcttgtggcgatacctcaagaat
gcctatgcacgggacgagttcaccaacacctgtgcagctgacagtgagatcgagttggcc
tacgcagatgtcgccaggcgcctcagccgatcgtga

DBGET integrated database retrieval system