KEGG   Mus musculus (mouse): 224814Help
Entry
224814            CDS       T01002                                 

Gene name
Abcc10, Mrp7, mFLJ00002
Definition
(RefSeq) ATP-binding cassette, sub-family C (CFTR/MRP), member 10
  KO
K05674  ATP-binding cassette, subfamily C (CFTR/MRP), member 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    224814 (Abcc10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    224814 (Abcc10)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    224814 (Abcc10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 AAA_29 AAA_16 AAA_23 DUF87 AAA_30 RsgA_GTPase KAP_NTPase
Motif
Other DBs
NCBI-GeneID: 224814
NCBI-ProteinID: NP_733780
MGI: 2386976
Ensembl: ENSMUSG00000032842
Vega: OTTMUSG00000036094
UniProt: Q8R4P9
Position
17; 17 C
AA seq 1501 aa AA seqDB search
MEGLLAQLCGTDAARPLPLWEGDTTGHCFTQLVLSALPHALLAVLSACHLGTPRTTNHSP
ALNPGWRLRLAASFLLSIFPLLDLLPVVLPPGSRPGPLWLEVLAGCVTAVAWFTHSLALW
ALVHSPHGRSRGPLALALAAFLPTPALVLTLLWHCQRGTFLPPLLPGPLGRVCLLILQLA
AVLAYGLGWAAPGGPQEPWTHDPFLSSESQETEVAEDGESWLSRFSYAWLAPLLARGVRG
ELQQPRDTCRLPRRLHPAFLARVFQAHWKEGAQLWRALYRAFGCCYLALGLLKMVGTMLG
FSGPLLLSLLVGFLEEGQEPLSHGLLYVLGLAGGTVISAVLQNQYGYEVRKVTLQARVAV
LSTLYRKALKLGPSRPPTGEVLNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQV
GMAFLAGLVLALLLVPVNKVIATRIMASNQEMLRHKDARVKLMTELLSGIRVIKFFRWEQ
ALGDRVKACRTKELGRLRVIKYLDAACVYLWAALPVVICITIFITYVLMGHQLTATKVFT
ALALVRMLILPLNNFPWVINGLLESKVSLDRIQRFLDLPSYSPEAYYSPDPPAEPSTALE
LHEALFSWDPIGASQKTFISHLQVKKGMLVGIVGKVGCGKSSLLAAITGELHRLCGWVAV
SELSKGFGLATQEPWIQCATIRDNILFGKTFDAQLYREVLEACALNDDLSILPAGDQTEV
GEKGVTLSGGQRARIALARAVYQEKALYLLDDPLAAVDADVANHLLHRCILGVLSHTTRL
LCTHRTEYLERADVVLLMEAGQLVRTGPPSEILPLVQAVPTAWAEKEQVATSGQSPSVCD
LERTTEEELEVEQSTCGCLVQEESKSEGAVALHVYRAYWRAMGSGLAAAILVSLLLMQAT
RNGADWWLAHWLSQLKAGRNGSREDPASCSPGSTALFSPRLLLFSPGNLYTPLLSTPLHK
AASNGTADVHFYLIVYATIAGVNSLCTLLRAVLFAAGALQAAASLHHRLLHRLLMAPVTF
YDSTPSGRVLNRFSSDVACVDDSLPFLLNILLANSVGLLGLLAVLGSGLPWLLLLLPPLS
FVYYSVQGYYRASFRELRRLGSLTWSPLYSHLADTLAGLPVLRAAGATYRFEEENQRLLE
LNQRCQFASYATMQWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLVLSYALSLT
GLLSGLVSSFTQTEAMMVSVERLEEYSCDVPQEPHSQPLQSPHQQRISWLTQGSVEFQDV
VLVYRPGLPNALDGVTFRVEPGEKLGIVGRTGSGKSSLFLVLFRLLEPNAGRVLLDNVDT
SQLELAELRSQLAVIPQEPFLFSGTIRENLDPQGLHEDRALWQALEQCHLSEVAVAMGGL
DGELGERGQNLSLGQRQLLCLARALLTDAKILCIDEATASVDQKTDQLLQQTICKRFANK
TVLTIAHRLNTILNSDRVLVLQAGRVVELDSPSALRNQPHSLFQQLLQSSQQGAHSGPSG
C
NT seq 4506 nt NT seq  +upstreamnt  +downstreamnt
atggaggggctcctggcccagctgtgtggcacggacgcggcgcggccgctcccgctgtgg
gaaggggacacgacgggccactgcttcacccagctggtgctcagcgcccttccccacgcg
ctcctcgccgtcctcagtgcctgccacttgggcaccccaaggactaccaatcactcccca
gctctcaatcctggctggcgcctccgactcgcagcatccttcctcctttccatcttccca
ctgctagacctccttccagttgttttgcctccagggtcacgcccagggcccttatggcta
gaggtgctagcagggtgtgtgacagctgtggcctggttcacccacagcctggccctgtgg
gcactggttcattcccctcatggccgttcccgtggacccttggccttggctctggcagcc
tttctaccaaccccggccctggtactaactctgctgtggcattgccagcgaggtacattt
ctgcccccacttctcccaggacctctgggccgtgtgtgtcttctcattctgcaactggca
gcagtcttggcctatgggttgggctgggcagcccctgggggaccacaagagccctggact
catgatcccttcctgtcctctgagagtcaagaaacagaggtagctgaagatggagagagt
tggctgtcacgcttttcctatgcctggttggcacccttgcttgctcgtggagtccgagga
gagctccagcagccccgggacacttgccgcctcccccgcaggctgcatcctgccttcctg
gcccgagttttccaagcacattggaaggagggggcccaactgtggagggccctgtacagg
gcctttggatgttgctacctggcccttggactgttgaagatggtggggaccatgctggga
ttctccgggcctctgctgctctccctcctggtgggcttcctggaggaaggtcaagagcct
ctaagccacggcctgctctatgtcctggggttggctggtgggactgtgataagtgctgtg
ctgcagaatcagtatgggtatgaggtccgtaaagtgacacttcaggcacgagtggctgtg
ctgagcaccctctaccgcaaagccctgaagcttgggcccagccgccctcccaccggggag
gtcctgaacctactaggcaccgactccgagaggctgctcaactttgctggcagcttccat
gaggcctggggcctgcctctgcagctggccatcactctctacctgctgtaccagcaggtg
ggcatggccttcctggctgggctggtcttggcgctgctgctggtacctgtcaacaaagtg
attgccacccgaatcatggccagcaaccaggagatgctacggcacaaggatgcacgggtt
aagctcatgacagagttactgagtggcattcgagtcatcaaattcttcaggtgggagcag
gctctgggggaccgagtgaaggcttgccggactaaagagctgggacgactccgtgttatc
aaatacttggatgcagcctgtgtgtacctctgggctgccctgccagtggtcatctgcatc
accatcttcatcacctatgtcctcatggggcaccagctcactgccaccaaggtgtttaca
gcgctggcgcttgtgcgcatgctcattcttcctctcaacaacttcccctgggtgatcaat
ggtctcttggaatccaaagtatccctggaccggatccagcgtttcctcgatcttccaagc
tacagccctgaggcctattacagtcctgatccccccgcagagccctccacagcactggag
ctgcacgaggccctgttctcctgggacccaattggagcaagccagaagaccttcatcagt
cacctccaagtgaaaaagggtatgctggtgggcatcgtgggaaaggtgggctgtgggaag
agttcgctgctggccgccatcactggggagctccacaggctgtgtggatgggtggcagtg
tcagaactgtccaaaggctttggactagccacccaggaaccctggatccagtgtgccacc
atccgagacaacatcctctttgggaagacatttgatgctcaactatacagggaggttctg
gaggcctgcgccctcaatgatgatctaagtatcctgcctgctggagaccagacagaggtt
ggagagaaaggtgtgaccctcagcgggggacagagggcccggattgcacttgcccgtgct
gtctaccaggagaaagcactctatctcctcgacgaccctctggctgctgtggatgcagat
gtggccaaccacctgttacacaggtgcatcctgggagtgctgagccacaccacccggctg
ctgtgcacccaccgcactgagtacctggaaagggctgatgtggtgctgttgatggaagcc
gggcaattggtccgaacagggcctccctctgagatcctgccgctggtacaagctgtcccc
acagcctgggctgagaaggaacaagtggctacctcaggccagtccccatctgtatgcgac
ctggagagaaccaccgaggaggagttggaggtggaacagagcacatgcggctgcctcgtg
caggaggaaagcaaaagcgagggcgccgtagccctgcacgtctaccgagcatactggagg
gccatgggcagcggcctggccgccgccatcctcgtctctctgctcctcatgcaagccacg
cgcaacggtgctgattggtggctcgctcactggctgtctcagctgaaggccggcagaaat
ggatccagggaggatccagcttcctgcagcccaggctccacagcactcttctccccacgg
ctgcttctcttctcccctggaaacctctacaccccactgctcagcaccccactgcacaag
gctgcttccaatggcaccgcagacgtccacttctacctcatcgtgtatgcaaccattgca
ggggtgaactccctctgcacccttctccgggctgtgctctttgcagcaggcgcccttcaa
gcagctgccagcctacaccaccgcctactgcatcgactcctcatggcaccggtgactttc
tatgactccacaccttccggccgggtcttgaaccgcttctcatcagacgtagcctgtgta
gacgacagcctgcccttcctcctcaacatcctgctggccaattccgtgggcctgctgggc
ctcctggctgtcctaggttctggtctgccctggctgctgctcctgctaccacctctgagc
ttcgtctactacagcgtgcagggctactacagggcttccttccgggagctacggcgcctg
ggcagcctcacctggtctccgctctactcccatctggctgacaccctggcaggcctccct
gtgctccgggctgcaggggccacttacaggtttgaagaggagaaccagcgactcttggag
ctgaaccagaggtgccagtttgcttcctatgccacgatgcagtggttggacattcgactg
cagctcatgggggcagcagtggtcagcgccattgcgggcattgccctggtgcagcaccag
cagggccttgccaacccagggctggtgggcctcgtgctttcttatgccctgtctctgacg
ggcctgctctcgggtctggtgagcagtttcacacagacggaagccatgatggtgagcgtc
gagcgactggaggagtattcctgtgacgttccccaggagccccacagccagccactgcag
tcaccccaccagcagcgcatcagctggctgacccagggaagtgtggaattccaggacgtg
gtgctggtgtaccggccagggctgccaaatgccctagatggggtgaccttccgtgtggag
cctggagagaagctgggcatcgtgggccgcacaggctccggcaagtcttccctgtttctg
gtgctcttccggctgctggagcccaacgcagggcgagtgctcctggacaatgtggacacc
agccagctggagctggccgagctcagatcccagctggctgtcatccctcaggagcctttc
ctgttcagcgggactattcgggagaacctggacccccagggcctacacgaggacagggcc
ctgtggcaagccttggaacagtgtcacctgagtgaggtggctgtcgccatgggtggcctg
gatggagagctgggagaaaggggccagaacctgtccctaggacagagacagctgctgtgt
ctggcaagggctcttcttacagatgctaaaatcttgtgcattgacgaggccacagcaagt
gtggaccagaagacagaccagctgctccagcaaaccatctgtaaacgctttgccaacaag
acagtgctgaccatcgcccacaggctcaacacgatcctaaactctgaccgtgtgctggtg
ctccaagccgggagggtggtggaactggactccccctcagccctgcgcaaccagccgcac
tccctgttccagcagctcctgcagagcagccagcagggagcccactccggaccttcaggg
tgctga

DBGET integrated database retrieval system