KEGG   Mus musculus (mouse): 224824
Entry
224824            CDS       T01002                                 

Gene name
Pex6, AI132582, D130055I09Rik, PAF-2
Definition
(RefSeq) peroxisomal biogenesis factor 6
  KO
K13339  peroxin-6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    224824 (Pex6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    224824 (Pex6)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    224824 (Pex6)
SSDB
Motif
Pfam: AAA AAA_16 AAA_11 AAA_33 AAA_22 AAA_5 RuvB_N AAA_lid_3 NACHT TsaE AAA_25 AAA_19 TIP49 AAA_30 AAA_18 RNA_helicase Mg_chelatase NTPase_1 Vps4_C IstB_IS21 bpMoxR DUF2075 AAA_2 PhoH
Other DBs
NCBI-GeneID: 224824
NCBI-ProteinID: NP_663463
MGI: 2385054
Ensembl: ENSMUSG00000002763
Vega: OTTMUSG00000026320
UniProt: Q99LC9
Position
17; 17 C
AA seq 981 aa
MALAVLRVLDPFPTETPPLAVLLPPGGPWPATGLGLVLALRPASESPAKPALLVAAVEGS
GAQGEQRGPGPPPLLVSRALLRVLALGPGARVRARLVRRPPALGWALLATAPGPGLGPRV
GPLLVRRGETLPVPGSRVLETRPALQGLLGPGTRLAVTELRGRAKLGQESRDHSHPPPPP
VVSSFAASHSVRRLRGVLGGTGDALGVSRSCLRSLGLFQGEWVWVAQVAELPNSSQPRLA
QVQVLEPRWELSERLGPNSGQQPGEPLADGLVFLPATLAFNLGCDPLEVGELRIQRYLEG
SIAPENKGSCSPLPGPPFARELHIEILSSPHYSANGNYDHVLYRHFQTPRVVQEGDVLCV
STAGQVEILEGSLERLPRWREMFFKVKKTVGEAPEGPASAFLADTTHTSLYLAGTALSHV
PSLPSGRSPPWDSLSPPGLEALVNELCAILKPHLQPGGTLLTGTSCVLLQGPPGSGKTTA
VTAACSRLGLHLLKVPCSSLCADSSRAVETKLQATFSRARRCRPAVLLLTAVDLLGRDRD
GLGEDARVAATLRHLLLDEDALSRCPPLMVVATTSRVQDLPTDVQTAFPHELEVPVLSEA
QRLSILQALTAHLPLGQEVNLPQLARRCAGFVVGDLYALLTHTCRAACTRIRASGSAGGL
SEEDEGDLCVAGFPLLAEDFGQALDQLQTAHSQAVGAPRIPSVSWHDVGGLQDVKKEILE
TIQLPLEHPELLSLGLRRSGLLLHGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVG
QSEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHST
QDVFVIGATNRPDLLDPALLRPGRFDKLVFVGASEDRASQLRVLSAITRKFKLEASVSLA
NVLDCCPPQLTGADLYSLCSDAMMTALKRRVRDLEEGLELRSSALLLTMEDLLQAAARLQ
PSVSEQELLRYKRIQRKFAAC
NT seq 2946 nt   +upstreamnt  +downstreamnt
atggcgttggctgtcctgcgcgtcctggaccccttcccgacggagacaccaccgttggcg
gtgctgttgcctcccgggggcccgtggccagcgacggggctggggctggtgctggcactg
cggccggcgagcgagagtcccgcgaagcccgcgctgctcgtggcggccgtggaagggtcc
ggcgcccagggcgagcagcgcgggccggggcctccgccgctgctggtgagccgcgcgctg
ctgcgggtcctagcgctggggcccggggcgcgagtacgagcgcggcttgtgcggcgtccc
ccggccctgggctgggcgttgcttgccacggctccgggacccgggctagggcctcgagtc
gggccgctgttggtgcgccgcggggagaccctccccgtgcccggatcgcgagtgttggag
acgcgaccggccctgcaggggttgctgggcccggggacacggctggccgtgactgagctc
cgcgggcgggccaaactgggccaggagagtcgggatcacagccatcccccgcccccgccc
gtagtgtcgtcctttgcagcttcccactcggtccggcgactccgaggggttctgggaggg
actggagatgcgctgggtgtgagccggagctgtctccggagtctcggactcttccagggc
gaatgggtctgggtggcccaggtcgcagagttacccaactcctcgcagccgcgcttggct
caagtccaggttctagaaccgcgctgggagctgtctgagagactgggacccaactccggg
cagcagccgggagagccactcgctgacggactggtgtttctgcccgccactctggctttt
aatctcggctgtgaccccctggaagtgggagagctcagaattcagaggtatttggaaggc
tccatcgccccagagaacaaaggaagctgttcaccactgcccgggcctccgtttgctcga
gagttacacattgagattctgtcctcgcctcactacagtgctaatggaaattatgaccat
gtcctgtaccggcactttcagacacccagggtggtccaggaaggggatgtgttgtgtgtg
tcaacagctgggcaagttgagatcctggaaggaagcctggagagactgcccaggtggcgg
gagatgtttttcaaagtgaagaaaacggttggagaagccccagaggggccagccagtgcc
tttctggctgataccacccacacctctttatacctggctggcaccgccctgagtcatgtg
ccatcgctgccttcaggaaggtccccaccctgggacagcttgtctcctccaggcctggag
gccttggtaaatgagctgtgtgctatcctgaagcctcacctgcagcccggaggaacattg
ctcacaggaaccagctgtgtgcttctgcagggtcccccaggcagcgggaagaccacagcc
gtcacggctgcatgcagccgccttgggctccatttgctgaaggtgccctgctccagcctc
tgtgcagacagcagtagggccgtggagacaaagctgcaggccaccttctcccgggcccgc
cgctgcaggcctgcagtcctcctgttgacagctgtggacctcctgggccgggaccgagac
ggactgggtgaggatgcccgtgttgcggccacactccgtcatctcctccttgatgaggac
gctctcagcaggtgccctcctctcatggtggtggctaccacaagccgtgtccaggacctg
cccaccgatgtgcagacggcatttcctcatgagctagaggtgccagtgctgtctgaggct
caacggctcagtatcctgcaggccctcactgcccaccttcccttaggccaggaggttaac
ctgccccagctggcacggcgctgtgcgggctttgtggtgggggacctctatgcccttctg
acccatacctgccgggcagcctgcaccaggatcagagcctcgggctcggcaggtggtttg
agtgaggaggatgagggggacctgtgtgtggctggctttcctttgctggctgaggacttc
gggcaggcattagatcaactgcagacagctcactcccaagctgtgggagcacccaggatc
ccttcagtgtcctggcacgacgtgggcgggctgcaggatgtgaagaaggagatcctagaa
accatccagctgcctctggaacaccctgagctgctcagcctgggcctaagacgatcaggc
cttctgctccatgggcccccaggcactggcaagaccctgctggccaaggccgtagccact
gagtgcagcctcaccttcctcagtgtaaagggaccggagctcatcaacatgtatgtgggc
caaagcgaggagaatgtccgggaagtgtttgccagggccagggctgctgctccctgtatc
atcttctttgatgaactggattccttagctccaagccgcggacggagtggagattctgga
ggggtgatggacagagttgtgtctcagctcctagccgagctggatgggctccacagcacc
caggatgtgtttgtgatcggagccaccaacagaccagacctcctggaccctgcccttctg
cggcctggcagatttgacaagctggtgtttgtaggggcgagtgaggaccgggcctcccag
ctgcgtgtgctgagcgccatcacacggaagttcaagctggaggcctctgtgagcctggca
aacgtgctggattgctgcccaccccagctgactggtgcagatctctattctctctgctct
gacgccatgatgactgccctcaaacgcagggttcgagacctagaggaagggctagagctg
cggagctcagcactgctgctcaccatggaggacctgttgcaggctgcagcccggctgcag
ccctcagtcagtgagcaggagctgttgcgatacaagcgcatccaacgcaagtttgccgcc
tgctag

DBGET integrated database retrieval system