KEGG   Mus musculus (mouse): 224826
Entry
224826            CDS       T01002                                 

Symbol
Ubr2, 9930021A08Rik, AI462103, AW540746, E130209G04Rik, mKIAA0349
Name
(RefSeq) ubiquitin protein ligase E3 component n-recognin 2
  KO
K10626  E3 ubiquitin-protein ligase UBR2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    224826 (Ubr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     224826 (Ubr2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    224826 (Ubr2)
SSDB
Motif
Pfam: PRT6_C ClpS zf-UBR zf-ANAPC11
Other DBs
NCBI-GeneID: 224826
NCBI-ProteinID: NP_001170845
MGI: 1861099
Ensembl: ENSMUSG00000023977
UniProt: Q6WKZ8 Q3UPU3
Position
17; 17 C
AA seq 1755 aa
MASEMEPEVQAIDRSLLECSAEEIAGRWLQATDLNREVYQHLAHCVPKIYCRGPNPFPQK
EDTLAQHILLGPMEWYICAEDPALGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPT
CVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHKLSSSEVVEEEDPL
VHLSEDVIARTYNIFAIMFRYAVDILTWEKESELPEDLEVAEKSDTYYCMLFNDEVHTYE
QVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCDQAKTVIVRNTSRQTKPLKV
QVMHSSVAAHQNFGLKALSWLGSVIGYSDGLRRILCQVGLQEGPDGENSSLVDRLMLNDS
KLWKGARSVYHQLFMSSLLMDLKYKKLFALRFAKNYERLQRDYVTDDHDREFSVADLSVQ
IFTVPSLARMLLTEENLMTVIIKAFMDHLKHRDAQGRFQFERYTALQAFKFRRVQSLILD
LKYVLISKPTEWSDELRQKFLQGFDAFLELLKCMQGMDPITRQVGQHIEMEPEWEAAFTL
QMKLTHVISMVQDWCALDEKVLIEAYKKCLAVLTQCHGGFTDGEQPITLSICGHSVETIR
YCVSQEKVSIHLPISRLLAGLHVLLSKSEVAYKFPELLPLSELSPPMLIEHPLRCLVLCA
QVHAGMWRRNGFSLVNQIYYYHNVKCRREMFDKDIVMLQTGVSMMDPNHFLMIMLSRFEL
YQLFSTPDYGKRFSSEVTHKDVVQQNNTLIEEMLYLIIMLVGERFNPGVGQVAATDEIKR
EIIHQLSIKPMAHSELVKSLPEDENKETGMESVIESVAHFKKPGLTGRGMYELKPECAKE
FNLYFYHFSRAEQSKAEEAQRKLKRENKEDTALPPPALPPFCPLFASLVNILQCDVMLYI
MGTILQWAVEHHGSAWSESMLQRVLHLIGMALQEEKHHLENAVEGHVQTFTFTQKISKPG
DAPHNSPSILAMLETLQNAPSLEAHKDMIRWLLKMFNAIKKIRECSSSSPVAEAEGTIME
ESSRDKDKAERKRKAEIARLRREKIMAQMSEMQRHFIDENKELFQQTLELDTSASATLDS
SPPVSDAALTALGPAQTQVPEPRQFVTCILCQEEQEVTVGSRAMVLAAFVQRSTVLSKDR
TKTIADPEKYDPLFMHPDLSCGTHTGSCGHVMHAHCWQRYFDSVQAKEQRRQQRLRLHTS
YDVENGEFLCPLCECLSNTVIPLLLPPRSILSRRLNFSDQPDLAQWTRAVTQQIKVVQML
RRKHNAADTSSSEDTEAMNIIPIPEGFRPDFYPRNPYSDSIKEMLTTFGTAAYKVGLKVH
PNEGDPRVPILCWGTCAYTIQSIERILSDEEKPVFGPLPCRLDDCLRSLTRFAAAHWTVA
LLPVVQGHFCKLFASLVPSDSYEDLPCILDIDMFHLLVGLVLAFPALQCQDFSGSSLATG
DLHIFHLVTMAHIVQILLTSCTEENGMDQENPTGEEELAILSLHKTLHQYTGSALKEAPS
GWHLWRSVRAAIMPFLKCSALFFHYLNGVPAPPDLQVSGTSHFEHLCNYLSLPTNLIHLF
QENSDIMNSLIESWCQNSEVKRYLNGERGAISYPRGANKLIDLPEDYSSLINQASNFSCP
KSGGDKSRAPTLCLVCGSLLCSQSYCCQAELEGEDVGACTAHTYSCGSGAGIFLRVRECQ
VLFLAGKTKGCFYSPPYLDDYGETDQGLRRGNPLHLCQERFRKIQKLWQQHSITEEIGHA
QEANQTLVGIDWQHL
NT seq 5268 nt   +upstreamnt  +downstreamnt
atggcgtcggagatggagcccgaggtgcaggccatcgaccgcagtttgctggaatgttct
gccgaagagatcgcagggagatggctgcaagcaaccgacctcaacagagaagtgtaccag
catttagcccactgtgtgcccaaaatctactgccggggccctaaccccttccctcagaag
gaagacacgctggcacagcacatcctgctgggaccgatggagtggtacatctgcgctgaa
gaccctgcgctgggatttccaaagctcgagcaggcaaacaagccttctcacctctgtggc
cgagtgtttaaagtgggggaacctacatactcctgcagagactgtgcagttgaccccacc
tgtgttttatgcatggagtgcttcctgggaagtatccatagagaccatcgatataggatg
accacatcgggaggagggggcttctgtgactgtggtgacactgaggcgtggaaagaggga
ccttactgccagaagcacaagctcagcagctctgaagttgtggaggaggaggatcctctt
gtgcatctatcagaagatgtgatcgccagaacttacaacatttttgctattatgtttcga
tatgcagtagatatactgacctgggaaaaagaaagtgaattgcctgaagacttagaagtg
gcagagaagagtgacacctactactgcatgctgtttaatgatgaggttcacacctatgag
caagtcatttatacccttcagaaagctgtgaactgtacacagaaggaagccattggcttt
gcaactacagttgatcgagatggccgtaggtctgtccgatatggagatttccagtactgt
gatcaagcaaagacagtcattgtgaggaacaccagcagacagaccaagccgctcaaagtt
caagttatgcactcctccgtggctgctcatcagaattttggtttgaaagctctgtcgtgg
ctgggaagtgttattggatactcagatggccttcgcaggattttgtgtcaagttggatta
caagaaggtccagatggcgaaaactcttctctggtcgacagactgatgcttaatgattcc
aaattatggaaaggggctaggagtgtgtatcaccagttgttcatgagcagcctgctcatg
gacctcaagtataagaagctgttcgcgcttcgatttgctaaaaactatgagcgtttgcag
agagattatgtgacagatgaccacgacagagagttttcagtcgcagacctctcggttcag
atattcacagttccttcacttgcgcgaatgctcctcacagaagagaacctgatgaccgtt
atcattaaggctttcatggaccatttgaaacacagagatgcccagggcagattccagttt
gaacgctacactgccctccaagccttcaagttcaggagagtccagagcctcatcttagat
ctcaagtatgtattgattagcaaaccaacggagtggtcagatgagctgaggcagaagttc
ttacaagggttcgatgccttcttggaattactgaagtgcatgcagggaatggacccgatc
acgcgtcaggtgggacagcacattgagatggagccagagtgggaagcagccttcacactg
cagatgaagctgacacacgtcatctcaatggtgcaggactggtgtgctctggacgaaaaa
gtgttaattgaagcttacaagaaatgcctggctgtgctgacacagtgtcatggcggattt
actgatggtgaacagccaatcacactcagtatttgtggacactcggtggaaaccatcaga
tactgtgtttcccaagaaaaagttagcattcacctcccaatttctcgcttgcttgcaggt
ttgcatgtattgttaagcaaaagtgaagtggcatataaatttccagagctcctacctcta
agtgaactgagcccacccatgttgatagaacatcctcttagatgtcttgtcttatgtgct
caagtgcatgctgggatgtggagaagaaatggcttctctctagtaaatcagatctattac
taccataatgtgaaatgcaggcgagagatgttcgacaaggacatagtgatgcttcagaca
ggtgtctccatgatggacccaaaccacttcctgatgatcatgctcagccgctttgaactc
tatcagctcttcagcacgcctgactatgggaagagattcagttctgaggttacccataag
gacgtcgttcagcagaacaacactctgatcgaagagatgctctacctcatcatcatgctt
gtgggagaaagattcaaccctggggttggacaggtggctgccacagatgaaatcaagagg
gagattatccatcagttgagcatcaagcctatggctcacagtgagctggtgaagtctctg
cctgaagatgagaacaaggagaccggcatggagagcgtcatcgagtccgttgcacatttc
aagaaacctgggctcacagggcgaggcatgtatgagctgaagccagagtgtgccaaagag
ttcaacctgtatttttatcatttctccagggcagagcagtccaaggcagaggaagctcag
cggaaattgaaaagagaaaataaagaagatacagcactccctcctccggctttgccaccg
ttctgccctttgttcgcgagtctggttaacatcttgcagtgtgacgtcatgctgtacatc
atgggaacgatcctgcagtgggctgtagagcatcacgggtctgcctggtcagagtccatg
ctacagagggtgctgcatttgatcgggatggctctccaggaagagaagcaccacttggag
aacgccgtggaagggcacgtgcagaccttcaccttcacacagaagatttcaaagcctggt
gatgcaccacataactccccgagcatcctagctatgctggagaccttgcagaacgccccc
tccctggaagcccacaaggacatgatcaggtggttgctaaagatgtttaatgcaattaag
aagataagagagtgttcatccagcagccctgtggccgaggcggagggaaccataatggag
gagagctcaagagacaaggacaaagcagagaggaaaagaaaagccgagatcgccagactg
cgccgggagaagatcatggcccagatgtctgagatgcagcggcacttcattgacgaaaac
aaagagctcttccagcagaccctagagctggacacctctgcctctgccactcttgacagc
agccctcccgtttcagacgcagctcttacagcactgggcccagcacagacacaggtccct
gaaccgagacagtttgtcacctgtatattatgtcaagaggagcaagaggtgactgtggga
agcagggcgatggtcttggcagcgtttgttcagaggtcaacggttctgtcaaaagacagg
acgaaaaccatcgcggacccagaaaaatatgatccattattcatgcaccccgatctgtct
tgtgggacacacactggcagctgtgggcacgttatgcatgcccattgttggcaaaggtat
tttgattccgttcaagccaaggagcagcgaaggcagcagcggctgcgcttgcacactagc
tacgatgtagagaatggcgagttcctctgcccgctctgtgagtgcctgagcaacacggtg
atccccctgctgcttcctcccaggagcatcctcagcaggaggttaaatttttcagaccaa
ccagatctggcacagtggacgagagcagtaacacagcagataaaggtggtccagatgctg
aggagaaagcacaatgctgctgacacgtcttcttcagaggacacagaagccatgaatata
ataccgatccccgaaggcttcaggcctgatttttatcctaggaacccatattctgatagc
ataaaagaaatgttaacgacatttggaacggctgcttacaaggtgggactgaaggttcat
cctaatgaaggtgacccccgtgtgcccatcctgtgctgggggacctgtgcatacaccatc
cagagcatagaaagaattttgagtgatgaggagaagcctgtttttggacctctgccttgt
agactggacgactgtctcaggtcgttaacacggtttgcagcagcacattggacagtggcg
ttacttcctgtggtacaaggacacttctgtaaactctttgcatccttggtgcctagtgac
agctatgaagacctcccgtgcatactagacatcgacatgtttcacttgctggtgggcctg
gtgctcgctttcccagctctgcagtgtcaggatttttcaggaagcagcctggccactggg
gacctgcacatcttccacttggttaccatggcacacatcgtacagatcttacttacctca
tgtacagaagagaatggcatggatcaagagaatcccactggggaagaagaactggccatt
ctctctttgcacaaaacacttcaccagtatactggaagtgccttgaaagaagccccctcc
ggctggcacctgtggaggagcgtccgggccgccatcatgcctttcctcaagtgctctgct
ttgtttttccactatttaaatggagtcccggcccctccagaccttcaagtttctggaaca
agccattttgaacacttatgtaactacctttccctaccaaccaacctcattcaccttttt
caagaaaacagtgacatcatgaactccctgattgaaagttggtgccagaacagtgaagtt
aaacggtatctaaatggcgagagaggagcgataagctaccccagaggagctaacaaactg
atagaccttccagaggattacagcagcctcattaaccaagcatccaatttctcgtgcccc
aaatcaggtggcgacaagagcagagctcctactctgtgcctcgtgtgtgggagtctcctc
tgctctcagagttactgctgccaagctgagctggagggtgaggacgtcggagcctgcaca
gcacacacctactcctgcggctccggggccggcatcttcctgagagtgcgggaatgtcag
gtgctatttttagctggcaaaaccaaaggatgtttttattctcctccttaccttgacgac
tatggagagaccgaccagggactcagacgaggaaatcctttacatttatgccaagagcgg
tttcgaaagatccagaagctctggcagcagcatagtatcacagaggagatcggacacgcg
caggaggctaaccagaccctggtcggaattgactggcagcatttataa

DBGET integrated database retrieval system