KEGG   Mus musculus (mouse): 224860
Entry
224860            CDS       T01002                                 

Gene name
Plcl2, PLC-L2, PR, PRIP-2, Plc, Plce2, mKIAA1092
Definition
(RefSeq) phospholipase C-like 2
  KO
K15370  inactive phospholipase C-like protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    224860 (Plcl2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   224860 (Plcl2)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y PH_12 EF-hand_like C2 PH_14 PH EF-hand_7 Mcp5_PH
Other DBs
NCBI-GeneID: 224860
NCBI-ProteinID: NP_038908
MGI: 1352756
Ensembl: ENSMUSG00000038910
UniProt: Q8K394
Position
17; 17 C
AA seq 1128 aa
MAECGRGAAGGALPTSPSPALGAKGALKAGAGEGGGGGGGGRLGHGRARYDSGGVSNGDC
SLGVSGDEARTSPGRGPLGVALARTPSPAAGPVPRDSKPGGLPRRSSIIKDGTKQKRERK
KTVSFSSMPTEKKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKK
DSEKAKIDIKSIKEVRTGKNTDIFRSNGISEQISEDCAFSVIYGENYESLDLVANSADVA
NIWVTGLRYLISYGKHTLDMLESSQDNMRTSWISQMFSEIDVDGLGHITLCHAVQCIRNL
NPGLKTSKIELKFKELHKSKDKAGTEITKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLD
TKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDP
EHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPD
NEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKIL
GDKLYTTSPNMEESYLPSPDVLKGKILIKAKKLSSNCSGVEGDVTDEDEGAEMSQRMGKE
NVEQPNHVPVKRFQLCKELSELVSICKSVQFKEFQVSFQVQKYWEVCSFNEVLASKYANE
NPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNVGWFR
QNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVV
DPYVYVEIHGIPADCAEQRTKTVNQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGD
EFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKG
KKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQC
MLAVSPRFLGPDNNPLVVLNLSEPYPTMELQAIVPEVLKKIVTTYDMMMQSLKALIENAD
AVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKN
ETLENLKQIHFAAVSCGLNKPGTENSEAQKPRRSLEAIPEKASDENGD
NT seq 3387 nt   +upstreamnt  +downstreamnt
atggcggagtgtggccggggcgccgcaggaggggccctgcccacctccccgagcccggcc
ctaggcgccaagggcgccctgaaagccggagccggggaaggcggaggtggtggcggggga
ggtcgcctcggccacgggcgggcgcgctatgacagcggcggggtttccaacggagactgc
agcctcggcgtgtccggggacgaagcccggaccagccctggcaggggacctctaggcgtg
gcgctcgcgcggacccctagcccagctgccggtccggtccccagggacagcaaaccgggc
ggcctgccccgccggagcagcatcatcaaggatggcacgaagcagaaaagggagcggaag
aagacggtgtcattcagcagcatgccgacagagaagaagatcagcagcgcaagtgactgt
atcaactcaatggttgagggctctgaactcaaaaaggttcgttctaactccagaatttac
catcggtattttctgctggacgccgacatgcaaagcctgaggtgggagccatctaagaag
gattctgagaaagccaagattgatatcaaatctatcaaggaagtgagaacaggaaagaac
acagatatattccgcagcaatggcatttctgagcagatctctgaagattgtgcattttca
gtcatatatggagaaaattatgagtcacttgatttggttgccaattctgcagatgttgca
aacatctgggtgacaggactccgctacctgatttcttatgggaaacatacacttgatatg
ctagaaagtagccaagacaacatgaggacttcttggatttcacaaatgtttagtgaaatt
gatgtagatggtcttggacatataactctgtgtcatgctgtccagtgtatcagaaacctc
aatcctggtctaaaaacaagcaaaattgagcttaagttcaaagaattgcataaatcaaag
gacaaagctggtactgaaatcacaaaggaggaatttattgaggtctttcatgaactttgt
actagacctgaaatttacttccttttagttcagttttcaagcaataaagaattccttgat
accaaggaccttatgatgtttcttgaggcagaacagggtgtagcacatatcaatgaggaa
ataagcctggaaattattcacaaatacgagccatccaaagaaggccaggaaaagggctgg
ctctccatagatggattcactaactacctgatgtcacctgattgttacatctttgatccg
gaacataagaaggtctgtcaggatatgaagcaacctctgtctcattactttataaactca
tctcataatacatacttaatagaggatcagttccggggtccctctgacatcacgggatat
atccgcgctctgaaaatgggttgcaggagcgttgaattagatgtgtgggatgggccagat
aatgagcctgtgatttacacaggccacaccatgacctctcagatagtcttccgcagcgtc
atcgacatcattaacaagtacgcgttctttgcttctgagtatcctctcatcttatgttta
gaaaaccactgctctattaaacaacagaaggtgatggttcaacacatgaagaaaatttta
ggagacaagctgtatacgacatcacccaacatggaggaatcttatctaccatccccagat
gtcctgaaagggaaaatactaatcaaagcaaagaagctgtcttcaaattgctccggcgtg
gaaggggatgttactgatgaggatgaaggagcagaaatgtctcagaggatggggaaagag
aatgtggaacaacccaaccatgtgcctgtgaagcggtttcagctttgcaaagaactgtcc
gagctggtcagcatctgtaaatccgtccagttcaaggagtttcaggtgtcgtttcaggtg
cagaagtactgggaagtgtgctcctttaatgaagtacttgcgagtaaatacgccaatgag
aaccccggggactttgtgaattacaataagcgtttcctcgccagggtcttccctagtcca
atgagaattgactcaagcaacatgaaccctcaggatttttggaaatgtggctgtcagatt
gtagccatgaacttccagactccagggctgatgatggacctaaacgttggctggtttagg
cagaatggaaactgtggctatgttcttcgaccagccatcatgagggaagaagtctccttc
ttcagtgccaacaccaaggactctgtcccaggagtttcacctcagttgcttcacatcaaa
atcatcagcggccagaactttcccaaacccaaagggtcgggtgccaaaggtgacgtggtg
gacccttatgtctatgtggaaatccacggaattcctgccgactgcgcggagcaaaggaca
aaaacggtgaaccagaatggagatgctcctatttttgacgagagctttgagtttcagatt
aacctccctgaactagccatggtgcgctttgtcgtgctggacgacgactacatcggcgat
gagttcatcggccagtacaccattcccttcgagtgtttacagacgggctaccgccatgtg
cctctgcagtccctgactggagaggtcctcgcccacgcttctctgttcgtccacgtggct
attactaacaggagagggggagggaagcctcacaaacggggcctttccgtgaggaaagga
aaaaagtcccgggaatatgcctctctgagaacactgtggattaaaactgtagacgaggtg
ttcaagaacgcccagccccccatacgggatgccacggacctgagagagaacatgcagaat
gcagtggtgtcgttcaaagagttgtgtggcctctcctccgtggccaacctcatgcagtgc
atgcttgccgtgtctcctcgattcctggggcctgacaataaccccctggtggtcttgaac
cttagtgagccctaccccaccatggagctgcaagccatcgtgcctgaggtgctgaagaag
attgtaacaacttatgacatgatgatgcagtccctcaaggcactgattgaaaatgcagac
gctgtgtatgaaaagatcgtgcactgtcagaaggcagccatggaatttcatgaacacttg
cacagcataggcaccaaggaggggctgaaggaacggaaactacagaaggcagtggagagc
tttacctggaatattacaatcttaaaggggcaagcggatcttctgaaatatgctaagaat
gagaccctggagaacctgaagcagatccactttgcagctgtttcctgtggactgaacaaa
ccaggcactgaaaactccgaggcccagaagccacgccggagcctagaagccatccccgag
aaagccagtgatgaaaatggagactaa

DBGET integrated database retrieval system