KEGG   Mus musculus (mouse): 224902
Entry
224902            CDS       T01002                                 

Gene name
Safb2, AA389433, AI255170, mKIAA0138
Definition
(RefSeq) scaffold attachment factor B2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: RRM_1 SAP RRM_5 Exonuc_VII_L
Other DBs
NCBI-GeneID: 224902
NCBI-ProteinID: NP_001025150
MGI: 2146808
Ensembl: ENSMUSG00000042625
Vega: OTTMUSG00000033212
UniProt: Q80YR5
Position
17; 17 D
AA seq 991 aa
MAEPGTGSGDPAFGPGASESGTRRLSDLRVIDLRAELKKRNLDTGGNKSVLMERLRKAFK
EEGQEPEEVGISWGAVSKRAVKRNTKGSKMEEEGSEDNGLEEDSRYGQDGVVILQSSQDR
DTMDTGVPDGMEAEDLSVPCLGKADTVNQILHAFDDSKEYVAAQLGQLPAQLLKHAVDEE
VFKNTLEASVSDLKVTLADEEAPMEPENEKILDILGETCKSEPVKEEGSELEQPFAQATS
SVGPDRKLAEEEDLFESCGHPEEEEEEEEEDQEEEQEEEGDLALASSSKSESPSTRCQWS
EADAPLAVVKRELADAPGGGGGTRHRRKRKRRRKHQAQAEALGTGGGAGMNCEPVGLEEP
VEQSSTAAQLPEATSQELVRAPTAALSPEPQDSKEDVKKFAFDACNDVPAPPKESSASEG
ADQKMSSVKEEQDIKPVIKDEKGRASCSSGRNLWVSGLSSSTRAADLKSLFSKHGKVIGA
KVVTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPSEKKSSDRR
ACDQKEKVPGPDRPHPVKIKTEKTVIKKEEKLERKEEKGPEDIKKEKDQDELTPGAAGHS
RVTKSGSRGMERTVVMDKSKGEPVISVKATSRSKDRSSKSQDRKSEGREKRDILSFDKIK
EQRERERQRQREREIRETERRREREQREREQRLDAFQERREKARLQRERMQLQCQRQRLE
RERLERERLERERMRVERERRKEQQRIMREREELRRQQEQLRAEQERRALRRPYDLDARR
DDGYWPEGKRAALEDRYRDFPRPDHRFHDFDHRDRGHYQEHVIDRRDGSRTRVEERDGQY
YPDDQHSHGRLLEHHAWDSGDGWHGYSSDKKLNEGQGLPPPPRVSREWAEHSSQLEEQQV
PVWHSAVDTNMTGHEHIRWRGAERGLAGGPGHGHVAAGRGGMAGQGSFAHGGHSQGYIVP
SGRLEGGGMASQDQGGRVPNPHPHPHFTRRY
NT seq 2976 nt   +upstreamnt  +downstreamnt
atggcggaacccgggaccgggtcgggcgaccccgcctttggtccgggcgcctcggagagt
gggacgcggcggctcagcgacctgcgggtgatcgacctgagggcggagctgaaaaagcgg
aacctggatacgggaggcaacaagagcgtgctgatggagcggctgaggaaggcatttaag
gaggaaggacaagaacctgaggaggttggaatcagctggggagctgtgagcaagagggct
gtaaagagaaacaccaaaggatccaagatggaggaggagggcagcgaggacaacggcctg
gaggaagattccagatatgggcaggatggggttgtgattcttcagagttcacaagacagg
gacaccatggatacaggtgtgccagatgggatggaggctgaggacctcagtgtgccctgc
ctggggaaggccgacaccgtcaaccagattcttcatgcttttgatgacagtaaagagtac
gtggccgcgcagctgggacagcttccagctcagctcctgaagcatgctgtggatgaggag
gtcttcaagaacactctggaagcttccgtgtcagaccttaaagtaactctggctgatgaa
gaagcccccatggaaccagaaaatgagaaaatactcgacattttgggggaaacttgtaaa
tctgagccagtaaaagaagaaggttcggagctggagcagccctttgcccaggccacgagt
agcgtggggccagacaggaagctggcggaggaagaggacctatttgagagctgcggccac
ccggaagaggaagaggaagaggaggaagaagatcaggaagaggagcaggaggaggaggga
gatttagctttggccagcagcagcaagtctgagtctccaagcactcggtgtcagtggagc
gaggcagatgccccgttagcagtagtgaaaagggagctggcagatgcgccgggtggaggt
ggaggtactcggcacaggcggaagcgcaagcgaaggcggaagcatcaggcgcaggcagaa
gctctgggcacaggtggaggtgccgggatgaactgcgagcctgtagggctagaggagcca
gttgaacagagtagcacggctgcccagctcccggaggccaccagccaggagctggtgcga
gcgcccacggcagccctgagccctgagccccaagatagcaaagaagacgtgaagaagttt
gcttttgacgcttgtaatgacgtccctgcgcctcctaaagagtcctcagccagtgagggc
gctgatcagaaaatgagctctgttaaggaagaacaagatataaagccagtcattaaagat
gaaaaaggccgtgccagctgtagctcaggaaggaacctgtgggtcagtgggctgtcctcc
agcacccgtgctgctgacctcaagagcctcttcagcaagcatgggaaggtcatcggagcc
aaggtggtcaccaatgcccgcagtccaggggctcggtgctatggatttgtgacaatgtcc
acgtcagatgaggccaccaaatgcattagccacctgcacagaactgaactacatgggagg
atgatctctgtggagaaggccaagaatgaaccctctgagaagaagtcgtcagacaggaga
gcatgtgaccaaaaggagaaggtgccagggccggacaggcctcaccctgtgaagatcaag
acggagaaaactgtgatcaagaaggaagaaaaactggaaagaaaagaggagaaagggcca
gaagacattaaaaaggagaaggatcaagatgaactcacaccaggagctgctggtcattct
cgagtcaccaaatcaggaagcagaggcatggagcgtacagtcgtgatggacaagtccaag
ggcgagcccgtcatcagtgtgaaggccacaagcaggtcaaaggacagaagctccaaaagt
caagaccgaaagtcagagggcagggagaagagagacatactgtcattcgacaagatcaag
gagcagcgggagagggagcgccagaggcagagggagcgtgaaatccgggagacagagcga
agacgggagcgggagcagcgagagcgggagcagcgtctggatgccttccaggagcgacgg
gagaaggctcgcttgcagcgggaacggatgcagctccagtgccagcggcagcggttggag
cgggagcggctggagcgggagaggctggagcgggagcgcatgagagtggagcgtgaaagg
cgcaaggaacagcagcgcattatgcgtgagcgggaggagctgcggcggcagcaagaacag
ctgcgtgctgagcaggaacggcgggcactgcgcagaccctacgacctggatgctaggaga
gacgatggctactggccagaagggaagcgtgcagccttagaggacagataccgagacttt
ccacggccagatcaccgcttccatgactttgatcaccgagatcgtggccattaccaggag
catgtcatagacaggcgggatgggtccagaaccagagtggaggagcgggatgggcagtac
tacccagatgaccagcacagccatggaaggctcctagagcaccatgcttgggattccgga
gacggctggcatggctacagctctgacaagaagttgaatgaaggccaagggctaccccct
ccccccagggtcagccgagagtgggcggagcacagctcacagttggaggagcagcaggtt
cctgtctggcacagtgctgtggacacaaacatgacgggccatgaacacatacggtggcga
ggtgctgagcggggccttgcaggaggacctgggcatgggcatgtggcagcaggccggggt
ggcatggctgggcaaggcagctttgcacacggtggacattcccagggctatattgtgccc
agtggtagactggaaggtggtggcatggccagccaggaccagggtggccgagttcctaac
ccccaccctcacccccacttcacccgccgctactga

DBGET integrated database retrieval system