KEGG   Mus musculus (mouse): 225027Help
Entry
225027            CDS       T01002                                 

Gene name
Srsf7, 35kDa, 9430065L19Rik, 9G8, NX-96, Sfrs7
Definition
(RefSeq) serine and arginine-rich splicing factor 7
  KO
K12896  splicing factor, arginine/serine-rich 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    225027 (Srsf7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    225027 (Srsf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    225027 (Srsf7)
Spliceosome [BR:mmu03041]
 Common components
  Common spliceosomal components
   SR proteins
    225027 (Srsf7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 zf-CCHC RRM_5 zf-CCHC_3
Motif
Other DBs
NCBI-GeneID: 225027
NCBI-ProteinID: NP_666195
MGI: 1926232
Ensembl: ENSMUSG00000024097
UniProt: Q8BL97 Q3THA6
Position
17; 17 E3
AA seq 238 aa AA seqDB search
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSR
SGSIIGSRYFQSRSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPHRSASPERMD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgctacgggcggtatggaggagaaaccaaggtatatgttggtaacctgggaact
ggtgctggtaaaggagagttagaaagggcattcagttactatgggcccttaagaactgtg
tggattgccagaaatcctccaggattcgcctttgtggaatttgaagaccctagagatgca
gaggatgcagttcgaggattggatgggaaagtgatttgtggttctcgagtgagggttgaa
ctatcaacaggcatgcctcggagatctcgttttgataggccacctgcccgtcgtcccttt
gatcctaatgatagatgctatgagtgtggtgaaaagggacattatgcttatgactgtcat
cgctatagccgacgaagaagaagcaggtcacgatctagatcccattcccgatccagggga
aggcgatactctcgctcccgcagcaggagccgaggacggaggtcaagatcagcatctcct
cgccgatcaaggtctgtgtctcttcgtagatcaagatcagcttcactcagaagatctagg
tctggttctataataggatcgaggtatttccaatcccgctcaaggtcgagatcaagatcc
aggtctatttcacgaccaagaagcagccgatcaaaatccagatctccatctcctaaaaga
agtcgttccccatcaggaagtccacacagaagtgcaagtccagaaagaatggactga

DBGET integrated database retrieval system