KEGG   Mus musculus (mouse): 225152
Entry
225152            CDS       T01002                                 

Gene name
Gjd4, 9430022F06Rik, Cx39, Cxnu
Definition
(RefSeq) gap junction protein, delta 4
  KO
K07630  gap junction delta-4 protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    225152 (Gjd4)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   225152 (Gjd4)
SSDB
Motif
Pfam: Connexin
Other DBs
NCBI-GeneID: 225152
NCBI-ProteinID: NP_694726
MGI: 2444990
Ensembl: ENSMUSG00000036855
UniProt: Q8BSD4
Position
18; 18 A1
AA seq 364 aa
MEKLNLLGFLIITLNCNVTIMGMIWLIVEVLLRMLVVVLAGSPIYEDEQERFICNTLQPG
CANVCYDLFSPVSPLRFWLVQSLALLLPSVVFGTYTLHRGAKLAAVGGACRPQVPDLSTA
YLVHLLLRMLLEAGLAFLHYFLFGFSVPARVSCSHVPCSGAVDCYVSRPTEKSLLILFFW
AVSALSFLLSLADLLWILPRRKTLRTTQWVNGEARPVCEVPAPPPCLLQNPQGYLSQGQV
DQEDRQEEQVVPEFPCMWTAGQSDNSNVGQACVSGLLEHSDQDASEATSSAGDRLTVAHT
AHELRFHRETSLDLGGKNTQADELSLATQSHLARHSSASKPQAPCRLTTSGSAPHLRTKK
SEWV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggagaagttgaacttgttgggattcctcatcatcaccttaaactgtaacgtgaccatc
atgggcatgatctggctgatcgtggaggtcttgctgaggatgctagtggtggtcttggca
gggtcacctatctatgaggatgaacaagagaggtttatttgcaacacactgcaaccagga
tgtgccaacgtttgctacgacctcttttccccagtgtcaccgctgcgattctggctagtg
cagagcctggccttgcttctgccttcggtggtctttggcacttacaccctacaccgcggt
gcgaagctggctgcagtggggggagcctgcaggccccaggtgcccgacctgtctactgcc
tacctggtgcacctactgctgcgcatgctgctggaggccgggctggccttcctgcactac
tttctctttggcttttctgtgcccgcccgcgtgtcttgctcgcatgtaccctgctcaggg
gctgtggactgctacgtgtcgcggcccacggagaagtcactcctgatactattcttttgg
gcagtgagtgcgctatccttcctgctcagcttggctgacctgctttggatcctgccgagg
agaaagacactgaggaccacgcagtgggtgaatggagaggctagaccagtctgtgaagta
cctgcacctcccccttgcctcttacaaaacccccagggctatcttagccaaggtcaggtg
gaccaagaggacagacaggaggaacaagttgtgcctgagttcccctgcatgtggacagca
gggcagagtgacaacagcaatgttggtcaggcctgtgtgtcggggctgctggaacattca
gaccaagatgctagtgaggccacttcctcagctggtgacaggctaacagtggctcacaca
gcacatgagctcagattccacagagagacttcactggacctggggggcaaaaacacccag
gcagatgaactctccttggctacccagagccacctggccagacacagttcagccagcaag
cctcaagctccatgccggctgaccacctcaggcagtgctccccatttgagaaccaaaaaa
tctgagtgggtgtga

DBGET integrated database retrieval system