KEGG   Mus musculus (mouse): 225192Help
Entry
225192            CDS       T01002                                 

Gene name
Hrh4, AXOR35, BG26, GPCR105, GPRv53, H4, H4R, HH4R
Definition
(RefSeq) histamine receptor H4
  KO
K04152  histamine receptor H4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    225192 (Hrh4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    225192 (Hrh4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    225192 (Hrh4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 225192
NCBI-ProteinID: NP_694727
MGI: 2429635
Ensembl: ENSMUSG00000037346
UniProt: Q91ZY2
Position
18; 18 A1
AA seq 391 aa AA seqDB search
MSESNSTGILPPAAQVPLAFLMSSFAFAIMVGNAVVILAFVVDRNLRHRSNYFFLNLAIS
DFLVGLISIPLYIPHVLFNWNFGSGICMFWLITDYLLCTASVYNIVLISYDRYQSVSNAV
SYRAQHTGIMKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTKDCEPGFVTEWYILTIT
MLLEFLLPVISVAYFNVQIYWSLWKRRALSRCPSHAGFSTTSSSASGHLHRAGVACRTSN
PGLKESAASRHSESPRRKSSILVSLRTHMNSSITAFKVGSFWRSESAALRQREYAELLRG
RKLARSLAILLSAFAICWAPYCLFTIVLSTYPRTERPKSVWYSIAFWLQWFNSFVNPFLY
PLCHRRFQKAFWKILCVTKQPALSQNQSVSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagtctaacagtactggcatcttgccaccagctgctcaggtccccttggcattt
ttaatgtcttcatttgcctttgctataatggtaggcaatgctgtggtcatcttagccttt
gtggtggacagaaaccttagacatcgaagtaattatttttttcttaatttggctatttct
gacttcctcgtgggtttgatttccattcctctgtacatccctcacgtgttgtttaactgg
aattttggaagtggaatctgcatgttttggctcattactgactatcttttgtgcaccgca
tctgtctacaatattgtcctcattagctacgatcgataccagtcagtttcaaatgctgtg
tcttatagggctcaacacactggcatcatgaagattgttgctcaaatggtggctgtttgg
atactggctttcttggtaaatggcccgatgattctggcttcagattcttggaagaacagc
acgaacacaaaggactgtgagcctggctttgttacagagtggtacatcctcaccattaca
atgctcttggaattcctgcttcctgtcatctctgtggcttatttcaatgtacagatttac
tggagcctgtggaagcgtagggctctcagtaggtgccctagccatgctggattctccact
acctcttccagtgcttcaggacacttacacagagctggggtggcttgcaggacaagtaat
cctggattgaaggaatcagctgcatctcgtcactcagaaagtcctcgaagaaagagcagc
atcctggtgtccttaaggactcacatgaacagcagtatcactgccttcaaagtgggttcc
ttctggcgatcggaaagtgcagcgcttcgccaaagggagtacgcagagcttctcagaggc
aggaagctagccaggtcactggccatccttctgagcgcttttgccatttgctgggctcca
tactgtctgttcacaattgtcctttcaacttaccccagaacggaacgccccaaatcggtg
tggtacagcattgccttctggctgcaatggttcaattcgtttgttaatccctttctgtac
cctttgtgtcacaggcgtttccagaaggctttctggaagatactttgtgtgacaaagcaa
ccagcgctgtcacagaaccagtcagtatcttcttga

DBGET integrated database retrieval system