KEGG   Mus musculus (mouse): 225326
Entry
225326            CDS       T01002                                 

Gene name
Pik3c3, 5330434F23Rik, Vps34
Definition
(RefSeq) phosphatidylinositol 3-kinase catalytic subunit type 3
  KO
K00914  phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04145  Phagosome
mmu04371  Apelin signaling pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05132  Salmonella infection
mmu05152  Tuberculosis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    225326 (Pik3c3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    225326 (Pik3c3)
   04070 Phosphatidylinositol signaling system
    225326 (Pik3c3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    225326 (Pik3c3)
   04140 Autophagy - animal
    225326 (Pik3c3)
   04136 Autophagy - other
    225326 (Pik3c3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    225326 (Pik3c3)
   05014 Amyotrophic lateral sclerosis
    225326 (Pik3c3)
   05016 Huntington disease
    225326 (Pik3c3)
   05017 Spinocerebellar ataxia
    225326 (Pik3c3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    225326 (Pik3c3)
   05152 Tuberculosis
    225326 (Pik3c3)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    225326 (Pik3c3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    225326 (Pik3c3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     225326 (Pik3c3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Macropinocytosis
   Kinases
    225326 (Pik3c3)
  Rab GTPases and associated proteins
   Rab associated proteins
    225326 (Pik3c3)
 Endosome - Lysosome transport
    225326 (Pik3c3)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    225326 (Pik3c3)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 HEAT_2
Other DBs
NCBI-GeneID: 225326
NCBI-ProteinID: NP_852079
MGI: 2445019
Ensembl: ENSMUSG00000033628
Vega: OTTMUSG00000021153
UniProt: Q6PF93
Position
18; 18 B1
AA seq 887 aa
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNATTRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQTSASESLSNSGVSSGDIDSSQIITNPLPPVASPPPASKAKEVSDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSETGPYGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgggggaggcggagaagttccactacatctacagctgtgacctggacatcaacgtgcag
ctgaagatagggagcttggaagggaagagagaacaaaagagctataaagctgtcctagaa
gatcccatgttaaagttttctgggctataccaagagacatgctccgacctctatgtgact
tgtcaagtgtttgctgaagggaagcccctggccttaccagtcagaacatcctacaaggcg
tttagtacaagatggaattggaacgagtggctgaaacttccggtgaagtaccctgacctg
cccaggaatgcccaagtggccttgactatatgggatgtgtatggaccgggaagcgctgtg
ccagtgggaggaacaaccgtgtcgctctttggaaaatatggcatgtttcgccaaggaatg
catgacttgaaggtctggcctaacgtggaggcagatggttctgaacctacaagaactccc
ggcagaacaagcagcacactgtcagaagatcagatgagccgcctcgccaagctcaccaag
gctcatcggcaaggacacatggtgaaagtggattggctggacagattaacatttagagag
atagaaatgataaatgagagtgagaaacgaagctctaatttcatgtacttgatggttgag
tttcgctgtgtcaagtgcgatgacaaggagtatggcattgtttactatgaaaaggatggt
gacgaatcatctccaattttaaccagttttgagttagtgaaagttcctgatcctcaaatg
tctatggagaatttagtggagagcaaacaccacaagcttgctcggagcttaagaagcggg
ccatctgaccacgatctcaaacccaacgctaccacaagagatcagctaaatattattgtg
agttacccaccaaccaagcaactcacatatgaagaacaagatcttgtttggaaatttaga
tattatcttactaatcaagaaaaagctctgacgaagttcttgaagtgtgttaattgggac
ctgccccaggaggccaagcaggccctggaacttctgggaaagtggaagccaatggatgta
gaggactccctggagctgctctcctctcattacaccaaccccaccgtgaggcgctacgct
gtggcccgcctgaggcaggccgatgatgaggatttgctgatgtacttactgcagctggtc
caggctctgaaatatgaaaactttgatgacataaagaatggtttggaacctaccaagaaa
gatagtcaaacttcagcatcagaaagtctgtcaaattctggagtcagttctggagacata
gatagctcccaaattataaccaaccctcttcctcccgtggcctcccctcctcctgcatct
aaagcaaaggaagtttccgatggggaaaatctcgagcaagatctatgtacgttcttgata
tcaagagcctgtaagaactcaacactggctaattatttatactggtatgtgatagtggag
tgtgaagatcaggacacccagcagcgggacccaaagactcacgagatgtacctgaacgtg
atgaggcgcttcagccaagccttgctcaagggtgacaagtctgtgagagtcatgcgctcc
ctgctggcggctcagcagacctttgtagatcgcctggtccatctgatgaaggcggtgcag
agagaaagtgggaaccgcaagaagaagaatgagagacttcaggccttgcttggagataat
gagaaaatgaacttatcagatgtggaactgatcccattgccgctggagccacaggtgaaa
ataaggggcatcatcccggaaacagctaccctgttcaagagtgctcttatgcctgcccag
ctgttcttcaagactgaagatggaggcaaatacccagttattttcaagcatggagacgac
ttgcgtcaagatcagcttattcttcagatcatctccctcatggacaagctgttacggaaa
gaaaacctggatttgaaattgaccccatacaaggtgttagccactagcacaaaacatggc
ttcatgcagttcatccagtcggttcctgtcgcagaagttcttgacacagagggaagcatt
cagaactttttcaggaaatatgcccccagtgagactggaccctatggcatcagtgcagag
gtcatggacacttacgttaaaagctgtgctggatactgtgtgattacgtacattcttgga
gttggagaccggcacctggataaccttttgttaacaaagacaggcaaactcttccatata
gatttcgggtatattttgggtcgagatccgaagcccctccctcctccgatgaagctgaac
aaggagatggtggaagggatgggtggcacccagagtgagcagtaccaagagttccgaaag
cagtgctacacagccttcctccacctgcgaaggtattccaatctgatcttgaacttgttc
tccttgatggttgatgcaaacattccagatattgctcttgaaccagataaaactgtaaaa
aaggttcaggataagttccgcctggacctgtcagatgaggaggctgtgcactacatgcag
agtctgatcgacgagagcgtccacgcactgttcgccgccgtggtggagcagatccataag
tttgcccagtactggagaaaatga

DBGET integrated database retrieval system