KEGG   Mus musculus (mouse): 225339Help
Entry
225339            CDS       T01002                                 

Gene name
Ammecr1l, 5430429D03Rik, AU022236, AU040755, AW111353, E230022H04Rik
Definition
(RefSeq) AMME chromosomal region gene 1-like
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: AMMECR1
Motif
Other DBs
NCBI-GeneID: 225339
NCBI-ProteinID: NP_705735
MGI: 2442711
Ensembl: ENSMUSG00000041915
UniProt: Q8JZZ6 Q3UAR8
Position
18; 18 B1
AA seq 310 aa AA seqDB search
MGKRRCVPPLEPKLAAGCCGVKKPKLSGSGTHSHGNQSTTVPGSSSGPLQNHQHVDNSSG
RENVSDLTLGPGNSPITRMNTASGALSPLPRPNGTANSTKNLVVTAEMCCYCFDVLYCHL
YGFPQPRLPRFTNDPYPLFVTWKTGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRF
PPLTREELPKLFCSVSLLTNFEDASDYLDWEVGVHGIRIEFINEKGIKRTATYLPEVAKE
QDWDQIQTIDSLLRKGGFKAPITSEFRKSIKLTRYRSEKVTISYAEYIASRQHCFQNGTL
HAPPLYNHYS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaagacgttgtgttcctccccttgagcccaagttggcagcaggctgttgtggg
gtcaagaagcccaaactatctggaagtggaacgcacagtcacgggaaccagtctacaact
gttcctggctcaagttcaggacctcttcaaaaccaccagcatgtggacaacagcagtggt
cgggaaaatgtatcggacttaactctgggacctggaaactctcctattacacgaatgaat
actgcatctggagccctgagccctctcccccggcccaatggaactgccaatagcactaag
aacctggtggtgactgcagagatgtgctgctactgctttgatgtgctctactgtcacctc
tatggcttcccacagccacggcttcctagattcaccaatgacccctatcctctctttgtg
acctggaagacagggcgagacaagcggcttcgtggctgcattgggaccttctcagccatg
aatcttcattcaggactcagggaatacacattaaccagtgcacttaaggacagccgattc
cctcccctgacccgagaggagctgcccaaacttttctgttctgtctccctccttactaac
tttgaagatgccagtgactacctggactgggaggtaggggtccatggaattcggattgaa
ttcatcaatgaaaaaggcatcaaacgcacagccacatatttacctgaggttgctaaggaa
caagactgggatcagatccagacaatagattccttgctcaggaaaggtggttttaaggct
ccaattaccagtgaattcagaaaatcaatcaaactcacaaggtatcgaagtgagaaggtg
acaatcagttatgcagagtatattgcttctcgacagcactgtttccagaatggcactctt
catgccccgcccctctacaatcattactcctga

DBGET integrated database retrieval system