KEGG   Mus musculus (mouse): 225523
Entry
225523            CDS       T01002                                 

Symbol
Cep120, A230075C01, AU016693, Ccdc100
Name
(RefSeq) centrosomal protein 120
  KO
K16459  centrosomal protein CEP120
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    225523 (Cep120)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    225523 (Cep120)
SSDB
Motif
Pfam: DUF3668 C2
Other DBs
NCBI-GeneID: 225523
NCBI-ProteinID: NP_848801
MGI: 2147298
Ensembl: ENSMUSG00000048799
UniProt: Q7TSG1
Structure
PDB: 
6EWP

Position
18; 18 D1
AA seq 988 aa
MVPKSDQLLIVVSILEGRHFPKRPKHLLVVEAKFDGEQLATDPVDHTDQPEFATELAWEI
DRKVLHQHRLQRTPIKLQCFALDPQTSAKETVGYIVLDLRTAQETKQAPKWYQLLSNKYT
KFKAEVQISLTLETDTKAQVDSYKAKAAPPRDGKVLASLAGVDPKDIVAVLNEEGGYHQI
GPAEHCTDPFILSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFSDLIN
PNFEPERASVRIRSSVEILRVYLALHSKLQIHLCCGDQSLGSTEIPLNGLLKKGSTEINQ
HPVTVEGAFTLDPPNRAKQKLAPVPLDLAPTVGVSVALQREGIDSQSLIELKTQNGHEAE
HSQKRVLTPIKEKTLTGPKSPRESPAPPPPPNQTPPTKDDATESEVESLQYDKDPKPTVK
GIGSVPASLAQPEATCGASEVVTSGQKIAVPAASHHFCFSVDLRSVHDLELSFPVNCILR
YSYPFFGSAAPIMTNPPVEVRKNMEVFLPQSYCAFDFATMPHQLQDTFLRIPLLVELWHK
DKMSKDLLLGVARIQLSNILSSEKTRFLGANGEQCWRQTYSESVPVIAAQGSNNRILDLS
YTMTLEDYGLVKMREIFVSESSQGVPAVDQKPSSPPPAPCPSEIQMEPRETLEYKAALEL
EMWKEMQEDIFESQLKQKELAHMQALAEEWKKRDRERESLVKKKVAEYSILEGKLQKALT
ELETREQQLASAEAELQRERKELQLERERNLQELQDSVRRARDDCVYQVELERLKLKQLE
EDKQRLQQQLNDAGNKYKTLEKEFQQFKDQQNNKPEIRLQSEINLLTLEKVELERKLESA
TKSKLHYKQQWGRALKELARLKQREQESQMARLKKQQEELEQMRLRYLAAEEKETVRTEQ
QELLDIRNELNRLRQQEQNQYQDCKEIASGKLGSPRGSGLEEGLDDYLTRLIEERDTLMR
TGVYNHEDRIISELDRQIREVLTKNSAS
NT seq 2967 nt   +upstreamnt  +downstreamnt
atggtccccaagtccgaccaactgctcatcgtcgtatccatcctcgaaggtcgccatttc
cccaaacgtccaaagcatctgctcgtggtggaagcaaagtttgatggggagcagctggct
actgatcctgtcgaccatactgaccagccagaatttgctactgagctagcctgggagatt
gacaggaaagtccttcatcagcaccggttacagcgcacgccgatcaaactccagtgcttt
gccttggacccgcagacttctgccaaggaaaccgtaggctacattgttttggacttaaga
acagctcaagaaacaaagcaggctcccaaatggtaccagctgctgagtaacaaatacacc
aagttcaaggccgaggtgcagatcagcctcactttggagacagatacaaaggcccaggtg
gatagttataaagcaaaagcagccccgcctcgggatggaaaagttcttgctagcctggca
ggagttgacccgaaggacattgttgcagtattgaatgaggaaggaggctaccatcagatt
ggaccagcggagcactgtactgacccctttattttgtcggtgacgattgcatttgccacc
cagttggaacagttaattccatgtaccatgaagcttccagaaaggcagcctgagtttttc
ttttactattctttactgggaaacgatgttacaaacgagcctttcagtgatttgatcaac
ccaaactttgagcccgagagggcatctgttcgtatacgcagcagtgtggagattctgcgt
gtgtacctggctcttcactctaaactgcagatccatctctgctgtggagaccagtcactt
ggcagtacagaaatacctttaaatggattactgaagaagggcagtacagagattaaccag
catccggtcacagtagaaggtgcttttacccttgaccctccaaaccgagccaagcagaag
ctagctccagtccctctggacctggccccaactgtgggcgtgtccgtggctctgcagaga
gaaggcatcgattcccagtctttaattgaattaaagacccagaatggacatgaggcagaa
cattcacagaagagagttttaacccccataaaggagaagacactcactgggccaaaatca
ccaagggagtcccctgccccgcccccacctccaaaccagacgcctccaaccaaggatgat
gcaacagaaagtgaagtggagagcctgcagtatgacaaggatccaaagcccactgtgaag
ggcatcggttctgtacctgcttcgctggcccagccagaggccacctgtggtgcgtcagaa
gtggtgacatcaggacagaagattgctgttccagcggcgtcacaccacttctgcttctca
gtagacttaagaagcgtccatgacttggaactcagttttccagtcaactgcatattgagg
tactcctacccattcttcggcagtgcagctcctattatgactaaccctcccgtagaagtt
cggaaaaacatggaggtttttcttcctcagtcttactgtgcgtttgattttgcaactatg
cctcaccagctccaagacaccttcctacggattcctctgctggtggagttatggcacaag
gataaaatgagtaaagatttactccttggggtcgcaagaatccagctttctaatatcttg
tcttcagaaaagacccggtttttaggtgctaatggtgagcagtgctggcgacagacgtac
agtgagagcgtgcctgtgatagcagcccaggggtcaaataacaggatattagacctttct
tatacaatgacactggaagactatggcctagtgaaaatgcgtgagatctttgtatcggag
tcatctcagggtgtgcctgctgtggatcagaagccatcttcgcctcctcccgctccctgc
ccttctgagatccagatggaacccagagagaccttagagtacaaggctgccctcgagctg
gagatgtggaaagagatgcaggaagacatatttgaaagtcagctgaagcaaaaagaactg
gctcacatgcaagctcttgcagaagagtggaaaaaaagggaccgggaaagagagtcacta
gtgaagaaaaaggtagctgaatacagtattctagaaggcaaacttcagaaggccctcacg
gagctagagacccgtgagcagcagctggccagtgcagaagcagagcttcagagagagaga
aaggagctgcagttagaacgggagcggaaccttcaagagctgcaggactctgtccgaagg
gccagagacgactgtgtgtaccaagtggagctggagaggctgaagctgaagcagctggaa
gaggacaaacagcggcttcagcagcagcttaatgatgctggcaataagtataagactttg
gaaaaagagtttcagcagttcaaggatcaacagaacaacaaaccagaaatccggctgcag
tcagaaataaacctcctcaccttggagaaggttgaacttgaaagaaagttggaatctgca
accaagtctaaactgcattacaagcagcagtggggccgagctttgaaagaacttgccaga
ctaaagcagagggagcaagaaagtcaaatggcccgccttaaaaaacagcaggaggagttg
gagcagatgcggctgcgttacctggcggctgaggagaaagaaacagtgagaactgagcag
caggaactgctggatataaggaacgagctgaacaggttaaggcagcaagaacagaaccag
taccaggactgcaaagagattgcaagtgggaagctgggcagcccgaggggctctgggctg
gaagaaggcttggatgactacctgacacgcctgatagaggaaagggacactctgatgaga
acgggtgtctataaccatgaggaccgcataataagtgaactcgaccggcagatcagagag
gttttgaccaaaaacagtgccagttaa

DBGET integrated database retrieval system