KEGG   Mus musculus (mouse): 225583
Entry
225583            CDS       T01002                                 

Gene name
Minar2, A730017C20Rik
Definition
(RefSeq) membrane integral NOTCH2 associated receptor 2
  KO
K24830  major intrinsically disordered Notch2-binding receptor 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    225583 (Minar2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Others
   225583 (Minar2)
SSDB
Motif
Pfam: MINAR1_C
Other DBs
NCBI-GeneID: 225583
NCBI-ProteinID: NP_776120
MGI: 2442934
Ensembl: ENSMUSG00000050875
Vega: OTTMUSG00000028219
UniProt: Q8C4X7
Position
18; 18 D3
AA seq 193 aa
MKGDMDLSVLPNNNHPDKFLQLDVKSLMRSSTLLQASLARFPGGNYPATQHWQNLVYSQR
EKTIATQRIKGFGVENPVLPESPPASMSSVMKNNPLYGDITLEEAMEERKKSPSWTIEEY
DKHSVHTNLSGHLKENPNDLRFWLGDTYTPGFDTLLKKKKKRNKRSKLCHMGLILLLVAS
ILVTIVTLSTIFS
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaaaggggacatggatctttctgttttgcccaataacaaccatcctgacaaattcctg
cagcttgacgtgaagtctttaatgaggagctcaacccttctgcaggctagcctcgcgaga
tttccgggtggaaattatcctgccacacaacactggcaaaaccttgtctactcacagaga
gaaaaaaccattgctactcagcgaatcaagggatttggtgtggagaacccagtccttcct
gagagtcctccagcatccatgtcttcagttatgaagaacaacccgttgtatggtgacata
actttggaagaagctatggaagaaaggaaaaagagtccttcatggaccattgaggagtat
gacaagcattctgtgcatacaaatctctctggacatctgaaggaaaaccccaacgacctg
cgcttttggttgggggatacgtacactcctggcttcgacactctgctgaaaaagaagaag
aaacgcaacaagcgatcaaaattgtgtcacatgggtctgattttactccttgtggcctcc
attctggttaccatagtgactctcagcaccatattctcttaa

DBGET integrated database retrieval system