KEGG   Mus musculus (mouse): 225631
Entry
225631            CDS       T01002                                 

Gene name
Onecut2, C730009D12, OC-2, Oc2
Definition
(RefSeq) one cut domain, family member 2
  KO
K24170  one cut domain family member 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    225631 (Onecut2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Cut
    225631 (Onecut2)
SSDB
Motif
Pfam: CUT Homeodomain Homeobox_KN SelP_N
Other DBs
NCBI-GeneID: 225631
NCBI-ProteinID: NP_919244
MGI: 1891408
Ensembl: ENSMUSG00000045991
Vega: OTTMUSG00000024794
UniProt: Q6XBJ3
Position
18; 18 E1
AA seq 505 aa
MKAAYTAYRCLTKDLEGCAMNPELTMESLGTLHGPVGGGSGGGGGGGGGGGGGGPGHEQE
LLASPSPHHAGRGAAGSLRGPPPPTAHQELGTAAAAAAAASRSAMVTSMASILDGSDYRP
ELSIPLHHAMSMSCDSSPPGMGMSNTYTTLTPLQPLPPISTVSDKFHHPHPHHHPHHHHH
HHHHHQRLSGNVSGSFTLMRDERGLPSMNNLYSPYKEMPSMSQSLSPLAATPLGNGLGGL
HNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPG
HTQSHGPVLAPSRERPPSSSSGSQVATSGQLEEINTKEVAQRITAELKRYSIPQAIFAQR
VLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEPN
KDRNNSQKKSRLVFTDLQRRTLFAIFKENKRPSKEMQITISQQLGLELTTVSNFFMNARR
RSLEKWQDDLGTGGSSSTSSTCTKA
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaggctgcctacaccgcctatcgatgcctcaccaaagacctagaaggctgcgccatg
aacccggagctgacaatggaaagtctgggcactttgcacgggccggtcggcggcggcagc
ggcgggggaggcggcgggggcggagggggcgggggcgggggcccgggccatgagcaggag
ctgctggccagccccagcccccaccacgcgggccgcggtgctgccggctcgctgcgcggc
ccgccgccgccaaccgcgcatcaggagctgggcaccgcagcggcggcggcagccgcggcg
tcgcgctcggccatggtcaccagtatggcctcgatcttggacggcagcgactaccgacca
gagctctccatcccgctacaccacgccatgagtatgtcctgcgactcgtcgccgccaggc
atgggcatgagcaacacctacactacgctgacgccgctccagccgctgccacccatctct
acggtctcagacaagttccaccacccgcaccctcaccaccaccctcaccaccaccatcac
caccaccatcaccatcagcgtctgtccggcaacgtcagtggcagcttcactctcatgcgg
gacgagcgcgggcttccgtccatgaacaacctttacagcccttacaaggagatgcctagt
atgagccagagcctgtctccattggctgccacgccgctgggcaacgggctgggtggcctt
cacaatgctcagcagagcctgcccaactacggtccgccgggccatgacaaaatgctcagc
cccaatttcgacgcgcaccacactgccatgctgacccgcggtgagcaacacctgtcccga
ggcctgggcaccccgcctgcggccatgatgtctcacctcaatggcttacaccaccctggc
cacactcagtcccacgggccagtgctggctcctagccgtgagcggcccccttcgtcctcc
tcgggttctcaggtggccacgtccgggcagctggaagagatcaacaccaaagaggtggcc
cagcgtatcaccgccgagctgaagcgctacagcatcccgcaggcgatcttcgcacagagg
gttctatgccggtctcaggggactctctccgacctgctccggaatcccaaaccctggagt
aaactcaaatctggcagggagaccttccgcaggatgtggaagtggctgcaggagcccgag
ttccagcgcatgtctgccttacgcctggcagcatgcaaacgcaaagagcaagaaccaaac
aaagacaggaacaactcgcagaagaaatcccgcctggtgttcacggacctccaacgccga
acactcttcgccatcttcaaggaaaataagcgcccttcgaaggagatgcagatcaccatt
tcccagcaacttgggctggagctgaccactgtcagtaacttcttcatgaatgcccggcgt
cgcagcctggagaaatggcaagatgacctaggcacagggggttcttcatccacctccagc
acttgtaccaaagcatga

DBGET integrated database retrieval system