KEGG   Mus musculus (mouse): 225642
Entry
225642            CDS       T01002                                 

Gene name
Grp, BLP
Definition
(RefSeq) gastrin releasing peptide
  KO
K05224  gastrin-releasing peptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    225642 (Grp)
SSDB
Motif
Pfam: Bombesin
Other DBs
NCBI-GeneID: 225642
NCBI-ProteinID: NP_778177
MGI: 95833
Ensembl: ENSMUSG00000024517
Vega: OTTMUSG00000037740
UniProt: Q8R1I2
Position
18 E1; 18 38.98 cM
AA seq 146 aa
MRGSELSLLLLALVLCQAPRGPAAPVSTGAGGGTVLAKMYPRGSHWAVGHLMGKKSTDES
PSLYAADRDGLKEQLRGYVRWEEAARDLLDLLEAAGNQSHQPPQHPPLSLQPTWDPEDGS
YFNDVQTAKLVDSLLQVLKEKGGTAS
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcgcggctcggagctctcgctcttgctgttggctctggtcctctgccaggcgccccgg
gggccagctgccccggtgtcgacaggcgcaggtggaggcacggtcctggctaagatgtat
ccgcgcggcagtcactgggctgtgggacacttaatgggaaaaaagagcacggatgaatcc
ccgtccctgtatgcggctgacagagacggcctgaaggagcagctgagggggtacgtccgc
tgggaagaagctgcaagggatttgctggacctcctagaagctgctgggaaccaaagccac
cagccacctcagcatccgcctctcagtctccagcctacttgggatcccgaggacggcagc
tactttaacgacgttcaaaccgctaagttggtagactctctgctccaggttctcaaggaa
aagggaggaactgccagctga

DBGET integrated database retrieval system