KEGG   Mus musculus (house mouse): 225659
Entry
225659            CDS       T01002                                 
Symbol
Cep76, 6230425F05Rik, 9630013E05
Name
(RefSeq) centrosomal protein 76
  KO
K16457  centrosomal protein CEP76
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    225659 (Cep76)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    225659 (Cep76)
   Centrosome duplication proteins
    Regulators of centriole replication
     225659 (Cep76)
SSDB
Motif
Pfam: CEP76-C2 Transglut_core3 Transglut_core
Other DBs
NCBI-GeneID: 225659
NCBI-ProteinID: NP_001074542
MGI: 1923401
Ensembl: ENSMUSG00000073542
UniProt: Q0VEJ0
Position
18:complement(67750034..67774425)
AA seq 659 aa
MSLPPEKASELKQLIHQQLSKMDVHGRIREILAETIREELAPDQQHLSTEDLIKALRRRG
IIDDVMKELNFVTDSVDQELPSSPKQTVGFDKQSTLKKTNVDPTRRYLYLQVLGGKAFLE
HLQEPEPLPGQICSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMA
DSTTMLSISDPIHMVLIKTDIFGETTLVASYFLEWRSVLGSENGVTNLTVELMGVGTESK
VSVGILNIKLEMYPPLSQTLSQEVVNTQLALERQKTAEKERLFLVYAKQWWREYLQIRPS
HNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFVNVLGYERAPVIGGGGKQ
EQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGAPHAWVMTCGTDGTI
MFWESLTGHRYIHKPTNPDGPPLAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCIF
DLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHR
KDLGLTTVWEDQLSYLLSPALASYEFERTTSISAGNEEFQDAIRRAVPDGHTFKGFPIHF
VYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYRSVL
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgtcgctgcctccggagaaagcctcggagctgaagcagctcatccaccagcagctgagc
aagatggatgtccatggcagaataagagaaattcttgcagagactatacgagaagaatta
gcaccggatcaacaacatttatcaacagaagatctgatcaaagctctaagacgtcgagga
atcattgatgatgtaatgaaagaacttaattttgtgactgatagtgttgatcaagaactc
ccttcttctccaaagcaaaccgttggttttgataagcagtcaacattaaaaaaaactaat
gttgatccaacacggaggtatctttaccttcaggttctgggtggaaaagctttcttggaa
catctgcaagaacctgagcctttgcctggacagatttgctcgactttcactttatgtttg
cactatcggaaccaacgatttcgctccaaacctgtaccctgcgcttgtgagccagatttc
catgacggctttttgcttgaagttcacagagaaagtttaggtgatggaactagaatggct
gattcaacaacaatgttatcaataagtgatccaattcacatggtactaatcaaaacagac
atatttggtgagaccactttagttgcgtcctatttcctggaatggagatcagttttgggc
tcagaaaatggagtgaccaatctgactgtggagctcatgggtgtaggcacagaatcaaaa
gtttccgtgggaattttaaatataaaacttgaaatgtacccaccgctcagccaaacgctg
tctcaggaggtagtgaacacacagcttgccttggaacgtcagaaaactgcagagaaagag
cgattatttctcgtctatgctaagcagtggtggagggagtatttgcaaattcgaccttct
cacaactcaaggctggtcaagatttttgcccaggatgagaatgggataaatagaccagtc
tgttcctacgttaagccacttcgagctggacgacttctggatactccgaggcaagcggct
cgatttgttaatgtccttggttatgaacgagcccctgttattggaggaggtggcaagcag
gaacagtggtgcactctgctggcttttctctgtagaaacaagggtgattgtgaggaccac
gctaacctgctgtgcagccttcttcttggctatggactggaggcctttgtctgtgtgggg
actaaggccaagggggcgccgcatgcctgggtgatgacctgtgggactgatggcaccatc
atgttttgggagagtttaacagggcacaggtacatccacaagcctaccaatcctgacgga
cctccacttgctgagcagcccaaaccactgtacccatatcgaacaattggttgtgttttc
aatcatcagatgttcctgggaaactgtcagccctcagatgcagtagagacctgcatattt
gatttgaatgatgagtccaagtggaaacccatgagcgaagaagcaattaagtctgtgtgt
gctccaggtgctactacctccctccctcccttcccacctctgtgtgcgtccacgattgac
gcctcggtcaccagcaatgaaatcgaaatgcagctgaggcttctggtgtcggagcacaga
aaggaccttggcctcaccactgtctgggaagaccagctctcctatcttttgtcaccagct
ctggcctcgtatgagtttgagcgaacaacaagcatatctgcaggcaatgaagaatttcag
gatgccatcaggagggctgtacctgacgggcacacatttaaaggcttccccatacatttt
gtgtatagaaatgcaaggcgtgcatttgccacttgtcttcggtctcctttttgtgaagaa
ataatctgttgtcgtggagaccaggtgcgactggcagttcgcgttcgagtgtttacctac
cctgagtctgcatgtgctgtttggatcatgtttgcttgtaaatatcgctcagtattatag

DBGET integrated database retrieval system