KEGG   Mus musculus (mouse): 225742Help
Entry
225742            CDS       T01002                                 

Gene name
St8sia5, ST8SiaV, Siat8e
Definition
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5
  KO
K03369  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8E) [EC:2.4.99.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00604  Glycosphingolipid biosynthesis - ganglio series
mmu01100  Metabolic pathways
Module
mmu_M00069  Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    225742 (St8sia5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    225742 (St8sia5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     225742 (St8sia5)
Glycosyltransferases [BR:mmu01003]
 Terminal extension
  Sialyltransferase
   225742 (St8sia5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 225742
NCBI-ProteinID: NP_038694
MGI: 109243
Ensembl: ENSMUSG00000025425
Vega: OTTMUSG00000028209
UniProt: P70126 Q3TRR3
Position
18; 18 E3
AA seq 412 aa AA seqDB search
MRYADPSANRDLLGNRTLLFIFICAFALVTLLQQILYSKSYIKRGFQFGWQRGDQQANWT
GLFNDSDSPTEQNITGSSSRYFEFYKEPLEFNSTRCLELRQEILEVKVLSMVKQSELFER
WKSLQICKWAMDTAEASLFKSTLSRCCNAPSFLFTTQKNTPVETNLRYEVESSGLYHIDQ
EIFKMFPKEMPYYRSQFKKCAVVGNGGILKNSGCGKEINSADFVFRCNLPPISGIYTTDV
GEKTDVVTVNPSIIIDRFHKLEKWRRPFFSVLQRYENASVLLPAFYNVRNTLVSFRVKYM
LDDFQSRQPVYFFHPQYLSSVSRYWLSLGVRARRISTGLILVTAALELCEEVHLFGFWAF
PMNPSGFFITHHYYDNVKPKPGFHAMPSEIFTFLRMHSRGILRVHTGTCNCC
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgcagacccctccgccaacagagatttgttggggaatcgaactttgctcttt
atcttcatctgcgcctttgccttggtgaccttgcttcagcagatcctgtacagcaagagc
tacatcaaaagaggcttccagtttggttggcagaggggcgaccaacaggccaattggact
gggctctttaatgacagcgacagcccaacagagcagaacatcactggctccagctccagg
tacttcgagttttacaaggagcctttagagtttaactccacgagatgcctggagctgagg
caggagatcctggaggtgaaggtgctgtccatggtgaagcagtctgaactcttcgaaagg
tggaagagtctccagatatgcaaatgggcaatggacaccgcggaagccagcctcttcaag
tccaccttgtccaggtgctgcaatgcccccagctttctcttcaccacccagaagaacacc
ccggtggagacgaatctcaggtatgaggtggaatccagcggcttatatcacatcgaccag
gagatcttcaaaatgtttcccaaggaaatgccctactaccgctctcagtttaagaagtgt
gctgtggtgggcaatggcggcatcttgaagaacagcggctgcgggaaggagatcaacagt
gctgactttgtcttccggtgcaacctgccccccatctcagggatatataccacagatgtg
ggagagaagacagatgtagtcaccgtgaatcccagcatcataattgacaggttccacaag
ttggagaagtggcggcggcctttcttcagcgtgctgcagaggtacgagaacgcctcagtg
ctgctgccagcgttctacaacgtccgcaacaccctggtatccttccgagtcaaatacatg
ctggacgacttccagtcgcggcagccggtctacttcttccacccgcagtacctgagcagt
gtgtcgcgctactggctcagcctgggtgtgcgcgcgcggcgtatcagcaccggcctcatc
ctggtcaccgcggccctggagctctgcgaggaggtgcacctgttcggtttctgggccttc
cccatgaacccctccggcttcttcatcacgcaccattactatgacaacgtcaagcccaag
ccgggtttccatgctatgccctcggagatcttcaccttcctgcgcatgcacagccgcggc
atccttcgcgtgcacacaggcacctgcaattgctgctga

DBGET integrated database retrieval system