KEGG   Mus musculus (mouse): 225845
Entry
225845            CDS       T01002                                 

Gene name
Plaat3, AdPLA, C78643, HRSL3, Hr, Hrasls3, Hrev107, MLP-3, Pla2, Pla2g16
Definition
(RefSeq) phospholipase A and acyltransferase 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04014  Ras signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    225845 (Plaat3)
   00565 Ether lipid metabolism
    225845 (Plaat3)
   00590 Arachidonic acid metabolism
    225845 (Plaat3)
   00591 Linoleic acid metabolism
    225845 (Plaat3)
   00592 alpha-Linolenic acid metabolism
    225845 (Plaat3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    225845 (Plaat3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    225845 (Plaat3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     225845 (Plaat3)
    3.1.1.32  phospholipase A1
     225845 (Plaat3)
SSDB
Motif
Pfam: LRAT Calici_PP_N NLPC_P60 Peptidase_C97
Other DBs
NCBI-GeneID: 225845
NCBI-ProteinID: NP_644675
MGI: 2179715
Ensembl: ENSMUSG00000060675
Vega: OTTMUSG00000033094
UniProt: Q8R3U1
Position
19; 19 A
AA seq 162 aa
MLAPIPEPKPGDLIEIFRPMYRHWAIYVGDGYVIHLAPPSEIAGAGAASIMSALTDKAIV
KKELLCHVAGKDKYQVNNKHDEEYTPLPLSKIIQRAERLVGQEVLYRLTSENCEHFVNEL
RYGVPRSDQVRDAVKAVGIAGVGLAALGLVGVMLSRNKKQKQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgctagcacccataccagaacccaagcctggagacctgattgagattttccgccctatg
tacagacactgggccatctatgttggtgatggatacgtgatccacctggctcctccaagt
gaaatcgcaggagctggggcagccagcatcatgtctgctttgactgacaaggccatagtg
aagaaagaactgctgtgccatgtggccgggaaggacaagtaccaggtcaataacaaacat
gacgaggagtacaccccactgcctctgagcaagatcatccagcgggctgagagactggtg
gggcaggaggtgctctacaggctgaccagcgagaactgtgagcactttgtgaatgaacta
cgctatggagttcctcggagtgatcaggtcagagatgcggtcaaggcggtaggcatcgct
ggagtgggcttggcggccttgggcctcgttggagtcatgctctccagaaacaagaaacag
aagcaatga

DBGET integrated database retrieval system