KEGG   Mus musculus (mouse): 225849
Entry
225849            CDS       T01002                                 

Gene name
Ppp2r5b, B'bet, B'beta, BC026670
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B', beta
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04728  Dopaminergic synapse
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    225849 (Ppp2r5b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    225849 (Ppp2r5b)
   04151 PI3K-Akt signaling pathway
    225849 (Ppp2r5b)
   04152 AMPK signaling pathway
    225849 (Ppp2r5b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    225849 (Ppp2r5b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    225849 (Ppp2r5b)
  09156 Nervous system
   04728 Dopaminergic synapse
    225849 (Ppp2r5b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    225849 (Ppp2r5b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    225849 (Ppp2r5b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    225849 (Ppp2r5b)
   03036 Chromosome and associated proteins [BR:mmu03036]
    225849 (Ppp2r5b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     225849 (Ppp2r5b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     225849 (Ppp2r5b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     225849 (Ppp2r5b)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 225849
NCBI-ProteinID: NP_937811
MGI: 2388480
Ensembl: ENSMUSG00000024777
Vega: OTTMUSG00000018606
UniProt: Q6PD28
Position
19; 19 A
AA seq 497 aa
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGCTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFL
RFIYELEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWRGLEELRLRRLQGTQGAKE
APVPRPTPQVAASGGQS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagacgaagctgccccctgcgagcacccccacaagcccctcctccccagggctgtct
ccagtgccaccaccagacaaggtggatggcttctcccgcaggtccctccgcagggcccgg
ccccgtcgctcacacagctcttctcagttccgctatcagagcaaccagcaagagctcact
ccactgcccctgctcaaagatgtgccagcctctgagttgcatgagttgctgagccggaaa
ctggcccaatgtggggtgatgtttgacttcttggactgcgtggctgacctcaaggggaag
gaggtgaagcgtgcagccctcaatgaactggtggaatgtgtgggttgcacccggggtgtg
ctcatcgagcccgtctacccagacatcatccgcatgatatcagtaaatatcttccggacc
ctgccacccagcgagaaccctgagtttgaccctgaagaagatgagcccaaccttgagccc
tcgtggccacatctgcagctggtatatgagtttttcctgcgtttcttggagagtccagat
ttccagccctctgtggccaagagatacgtggatcaaaagtttgtcctaatgctcctggag
ctatttgacagcgaggacccccgggaacgtgagtacctcaagaccatcttgcatcgggtg
tacggcaagttcctgggtctccgggcctacatccgcaaacagtgcaaccacatcttcctc
cggttcatctacgagctggaacacttcaatggtgtggctgagctcttagagatcttagga
agcatcatcaatggctttgcgctgcccctgaagactgagcacaagcagttcctggttcga
gtcctgatccccttgcactctgtcaagtcactatctgtttttcatgctcagctggcatac
tgtgtggtgcagttcctggagaaggatgcaaccttgacagagcatgttatccgggggctt
ctcaaatactggcctaaaacctgcacccagaaggaggtgatgttcctgggggagatggaa
gagattcttgatgtcatcgagccctcccagtttgtgaagatccaggagcccctcttcaag
caggtggctcgctgtgtctccagcccccatttccaggttgcagagcgggctctgtatttc
tggaacaatgagtacatcctgagcctcattgaggacaactgccacactgtgctgcctgcg
gtatttgggaccctctaccaagtgtccaaggagcactggaatcaaaccatcgtgtccctg
atctacaacgtgctcaagactttcatggagatgaacggaaagctgtttgacgagctcaca
gcctcctacaagctggaaaaacaacaggagcagcagaaggcccaggagcggcaggagcta
tggcgaggcttggaggaactgcggctacgccggctacaggggacccaaggggccaaggaa
gcccccgtcccacggcctacgccccaggtggctgccagtgggggtcagagctag

DBGET integrated database retrieval system