KEGG   Mus musculus (mouse): 225876Help
Entry
225876            CDS       T01002                                 

Gene name
Kdm2a, 100043628, 5530401A10Rik, AA589516, AW536790, Cxxc8, Fbl11, Fbl7, Fbxl11, Gm4560, Jhdm1, Jhdm1a, lalina
Definition
(RefSeq) lysine (K)-specific demethylase 2A
  KO
K10276  F-box and leucine-rich repeat protein 10/11 [EC:1.14.11.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    225876 (Kdm2a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    225876 (Kdm2a)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone H3]-dimethyl-L-lysine36 demethylase
     225876 (Kdm2a)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     225876 (Kdm2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    225876 (Kdm2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD_4 zf-CXXC JHD F-box F-box-like JmjC Cupin_8 LRR_4 Cupin_1
Motif
Other DBs
NCBI-GeneID: 225876
NCBI-ProteinID: NP_001001984
MGI: 1354736
Ensembl: ENSMUSG00000054611
Vega: OTTMUSG00000039985
UniProt: P59997 F6YRW4
Structure
PDB: 

Position
19; 19 A
AA seq 1161 aa AA seqDB search
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLQTNKYNANFVTFMEGK
DFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIE
MTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKES
QTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHN
LELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFL
HSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLS
MDMELNELESGNGDEEGVDREARRMNNKRSVLTSPVANGVNLDYDGLGKACRSLPSLKKT
LSGDSSSDSTRGSHNGQVWDPQCSPKKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPT
GIEDEDALIADVKILLEELASSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKP
HTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRM
KQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEG
LLNEELPNCWECPKCYQEDSSDKAQKRKIEESDEEAVQAKVLRPLRSCEEPLTPPPHSPT
SMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNP
SGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRPNPRVLMQHC
PARNPQHGDEEGLGGEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMSV
FRYLSRKELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSW
TNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRD
LLTPPTDKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQS
SNLLTAVGSSTRYSLTELNMAGCNKLTDQTLFFLRRIANVTLIDLRGCKQITRKACEHFI
SDLSINSLYCLSDEKLIQKIS
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggaacctgaagaagaaaggattcggtacagccagagattgcgtggtaccatgcgtcgt
cgctatgaagatgatggcatttcagatgatgaaattgaagggaaaagaacttttgacttg
gaagagaagctccaaaccaacaaatataatgccaattttgttacttttatggagggaaaa
gattttaatgtagagtatatccagcggggtggcttgagagaccctctcattttcaagaat
tctgatggacttggaataaagatgccggatccagacttcacagtgaatgatgtcaaaatg
tgtgtggggagtcgtcggatggtggatgtcatggatgtgaacacacagaaggggattgaa
atgaccatggcacaatggacacgatactatgagactccagaggaagagcgagaaaaactc
tataatgttatcagcctagagtttagccacaccaggcttgagaatatggtgcagcggcct
tccacggtggatttcattgactgggtagataacatgtggccaaggcacttgaaagaaagt
cagacagaatcaacaaatgccatcttagagatgcagtaccctaaagtgcaaaagtactgt
ctaatgagtgttcgaggctgctatactgacttccatgtggattttggaggtacttctgtt
tggtatcacatccaccaaggtggaaaggtcttctggctcatcccccctacagcccacaac
ctggagctgtacgagaattggctgctatcagggaaacagggagacatctttctgggtgac
cgggtgtcagattgccaacgaattgagctcaagcagggctataccttcgttattccctca
ggttggattcatgctgtgtatactcctacagacacattagtgtttggaggcaattttttg
catagcttcaacatccccatgcaattaaagatatacagcattgaagatcgaacacgggtt
ccaaataaattccgttacccattttactatgaaatgtgttggtatgtgttggagcgctat
gtatactgcataaccaaccgatcccacctaactaaggattttcagaaagaatcccttagc
atggatatggagttaaatgagttggagtctggaaatggtgatgaggaaggggtggacaga
gaagcccgacgcatgaacaataagcgatctgtgcttaccagccctgttgctaatggagtg
aacctggattacgatggacttggcaaagcctgccgaagtcttccaagtctgaagaaaact
ttgtctggagactcatcctcagactctacccggggatcccacaatggccaagtttgggat
ccccaatgtagccctaaaaaggataggcaagtgcatctcacccattttgaacttgaaggt
cttcgatgtcttgtagataagttagagtcactgccactgcacaagaagtgtgtccccaca
ggaatagaagacgaagatgctctgattgctgatgtaaagattttgctggaagaacttgcc
agtagcgatcccaagttagccctcactggagtccctatagtacagtggccaaaaagggat
aagcttaaattccctaccaggccaaaggtgagggttcctacaattcccatcacaaagcct
cacaccatgaagccagctccacgcttaacacctgtaaggcctgctgcagcctcccccatt
gtgtcaggagccaggcggagaagagtgcggtgcaggaaatgcaaagcttgtgtgcaagga
gaatgtggagtctgccactactgcagggacatgaagaaatttggtggacctggacgcatg
aagcaatcctgtgtcctccgacagtgcttagcacccagactgcctcattcagttacgtgt
tctctctgtggagaagtagatcagaatgaagagacccaggactttgaaaagaaactcatg
gaatgctgcatctgcaacgagatagttcatcctggctgcctccagatggatggagagggg
ttgctgaacgaggaattgccaaattgctgggagtgtccaaagtgttaccaggaagacagc
tcggacaaagcccagaagcggaaaatagaagagagtgatgaagaagctgtacaagccaaa
gtcttacggcccctgaggagctgcgaggagcctctcacacccccgcctcactcacctact
tccatgctgcagctcatccacgacccggtttctccccggggtatggtgactcggtcatcc
cctggggctggccccagcgaccaccacagtgccagccgtgatgaacgcttcaaacggcgg
cagttgctgcggctacaagccaccgagcgcaccatggtacgggaaaaggagaacaatccc
agcggcaaaaaggagctgtctgaagttgagaaagccaagatccggggatcgtacctcact
gtcactctacagaggcccaccaaagagctccacgggacatccattgtgcccaagctgcag
gccatcacggcctcctctgccaaccttcgccctaacccccgcgtgctaatgcagcactgc
ccagcccgaaacccccagcatggggatgaggaggggcttgggggagaggaggaggaagag
gaggaggaggaggaagatgacagtgcagaggaggggggtgcagccaggctgaatggccgg
ggcagttgggctcaggatggagacgaaagctggatgcagcgggaggtctggatgtctgtc
ttccgctacctcagccgcaaagaactttgtgaatgtatgcgagtgtgcaagacatggtat
aaatggtgctgtgataaacgactttggacaaaaattgacttgagtaggtgtaaggccatc
gtaccacaagctctcagtggtatcatcaagcggcagccagtaagcctcgacctcagctgg
actaacatctccaaaaagcagctgacatggctggtcaataggctgccaggattaaaagac
ctcctcctagcaggctgttcctggtctgcagtatctgccctcagcacttccagctgcccg
cttctcaggacccttgatcttcggtgggcagtaggaattaaagaccctcaaattcgggac
ttgctgactccacccacagataagccaggtcaagacaatcgaagcaaactccggaacatg
actgacttccggctggcaggccttgacatcacagatgctactctccgactcatcattcgc
cacatgccccttttgtctcgacttgacctcagtcactgcagtcaccttacagatcagtcc
tccaacctactaactgctgtcgggtcttccactcgatactcccttacagagctcaatatg
gcaggttgcaataaattgacagaccagaccctgttcttcctaaggcgaattgctaatgtc
accttgattgaccttcgaggatgcaaacagatcacgagaaaagcctgtgagcacttcatc
tcagacttgtccatcaacagcctctactgcctgtctgatgagaaactgatacagaagatt
agctaa

DBGET integrated database retrieval system