KEGG   Mus musculus (mouse): 225887Help
Entry
225887            CDS       T01002                                 

Gene name
Ndufs8, BC021616, CI-23kD, TYKY
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S8
  KO
K03941  NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:1.6.5.3 1.6.99.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer's disease
mmu05012  Parkinson's disease
mmu05016  Huntington's disease
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    225887 (Ndufs8)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    225887 (Ndufs8)
  Environmental adaptation
   04714 Thermogenesis
    225887 (Ndufs8)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    225887 (Ndufs8)
   05012 Parkinson's disease
    225887 (Ndufs8)
   05016 Huntington's disease
    225887 (Ndufs8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    225887 (Ndufs8)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     225887 (Ndufs8)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     225887 (Ndufs8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_21 Fer4_9 Fer4_10 Fer4_6 Fer4_8 Fer4_2 Fer4_4 Fer4_17 c-SKI_SMAD_bind Fer4_3 Fer4_13 Fer4_18
Motif
Other DBs
NCBI-GeneID: 225887
NCBI-ProteinID: NP_001258372
MGI: 2385079
Ensembl: ENSMUSG00000059734
UniProt: Q8K3J1 Q5M9P5 Q3UY05
Structure
PDB: 

Position
19; 19 A
AA seq 212 aa AA seqDB search
MYRLSSSMLPRALAQAMRTGHLNGQSLHSSAVAATYKYVNKKEQESEVDMKSATDNAARI
LMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCE
AICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETH
EELLYNKEKLLNNGDKWEAEIAANIQADYLYR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcctgagctcatcaatgctgccacgggccttggcccaggccatgcgcacagga
catcttaatggacaaagccttcatagcagcgcagtggcggcaacgtacaagtatgtgaat
aagaaggaacaggagtctgaggtggacatgaagtccgcaactgacaatgcagctcggatt
ctgatgtggacagaactcatccgaggactgggcatgaccctaagttacctctttcgagag
cctgccaccatcaactacccctttgagaagggcccactgagtccgcgcttccgtggggag
catgcactgcgccgctacccatctggagaggagcgttgcattgcctgcaaactctgtgag
gccatctgtcctgcacaggccatcaccattgaggctgagccaagagccgatggcagccgc
cgaacgacacgctatgacatcgacatgaccaagtgtatctactgtggtttctgccaggaa
gcctgccctgttgatgccattgtggagggccccaacttcgagttctccaccgagacacac
gaggagttgctgtacaacaaggagaagctactcaacaatggagacaagtgggaggccgag
atcgctgccaacatccaggctgactacctgtaccggtga

DBGET integrated database retrieval system