KEGG   Mus musculus (house mouse): 22589
Entry
22589             CDS       T01002                                 
Symbol
Atrx, 4833408C14Rik, AI447451, ATR2, DXHXS6677E, HP1-BP38, Hp1bp2, Hp1bp38, MRXS3, RAD54L, Rad54, XH2, Xnp, ZNF-HX
Name
(RefSeq) ATRX, chromatin remodeler
  KO
K10779  transcriptional regulator ATRX
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22589 (Atrx)
   03036 Chromosome and associated proteins [BR:mmu03036]
    22589 (Atrx)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    22589 (Atrx)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    22589 (Atrx)
SSDB
Motif
Pfam: SNF2-rel_dom ADD_ATRX Helicase_C
Other DBs
NCBI-GeneID: 22589
NCBI-ProteinID: NP_033556
MGI: 103067
Ensembl: ENSMUSG00000031229
UniProt: Q61687
Position
X:complement(104841221..104972978)
AA seq 2476 aa
MTAEPMSGNKLSTLVQKLHDFLAHSSEESEETCSSPRLVMNQSTDKICGSGLNSDMMENN
KEEGASTSEKSRSSGSSRSKRKPSIVTKYVESDDEKPTDENVNEKAATENSENDITMQSL
PKGTVIVQPEPVLNEDKDDFKGPEFRSRSKMKADNLKKRGEDGLHGIVSCTACGQQVNHF
QKDSIYRHPSLKVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFCK
KCILRNLGRKELSTIMDENNQWYCYICQPEPLLDLVTACNSVFENLEQLLQQNKKKIKVD
SEKTSKVCDQTSKFSPKKSSSSCNGEEKKLEESCSGSVSSTYSHSALSVPKEMIKKTTKL
IETTSNMNSSYIKFLKQAADNSEMTSAMKLCQLKSFKSVLDDIKKAHLALEEDLNSEIQA
LDDVHKEKNTKDLKSTDAKSETKLGKGEKSYSTEKREFLKLDARSSVKAIDGEEQRAHKS
TSGEHKGSGRKDGSQYEPTNTPEDLDMDIVSVPSSVPEDIFDSLESAMEVQSSADYQGDG
NSGTEPELESSSVKLNVSSKDSRGNIKSKVTAKVRKELFVKLTPVSLSNSPIKGVDCQEV
SQEKNGRKSSGVARSSEKCRPREEISDHENNVTILLEDSDLRRSPRVKTTPLRRQTESNP
AMSNSDEESNGTMKEKQKMSGPIRKKDKRNSADCATDNPKPHKVPKAKQPVIGDQNSDSD
EMLAVLKEASQMGHSSSSDTDINEPQMNHKGKTGKDDNGKRKRKNSTSGSDFDTKKGKST
ETSIISKKKRQNYSESSNYDSELEREIKTMSRIGAARKSVPEKKEEDSSEDEKQGKKVVD
NGGHERAKTTQEGSSADDTGDTEGRQGGSCSIAGGSIEKVRSGVEFREMLCKPGVSSDGA
EKPSVKEENVNSPEDKRVSKTKEKTKHLRSRQSRKGKGGSSDGTDRFPKKEQSDESSEGE
KKQSRQRPGTKGKKAPDLKGETLKREQEWDSSSDGTERLPEEEEIGPFSKGIKQSKTDTA
GGEKKGKKWKDKSCEKKEELSDSVDKLPGKGDSCDSSEDKKTRNRVSLREKKRFSLPAKS
PGKRPECSSSDTEKSLKGQCCDSTEKRPKRIDLRERRNSSSKRNTKEVKSASSSSDAEGS
SEDNKKQKKQRTSAKKKTGNTKEKKRNSLRATPKRKQVDITSSSSDIGDDDQNSAGEESS
DEQKIKPVTENLVLPSHTGFCQSSGDEALSKSVPATVDDDDDDNDPENRIAKKMLLEEIK
ANLSSDEDGSSDDEPDGGGKKRIGKQSEESPADDGELRREQLAVNQVNSESDSDSEESKK
PRYRHRLLRHKLTLSDGESGEEKPTKPKEHKEAKGRNRRKVSSEDSEDTDFQESGVSEEV
SESEDEQRPRTRSAKKAELEENQRSYKQKKKRRRIKVQEDSSSENKSHSEEDKKEGDEED
EEDEDEDEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEEEERRKRIAERERERE
KLREVIEIEDASPTKCPITTKLVLDENEETKEPLVQVHRNMVIKLKPHQVDGVQFMWDCC
CESVEKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFSTALVVCPLNTALNWM
NEFEKWQEGLNDNEKLEVSELATVKRPQERSYMLQRWQEDGGVMIIGYEMYRNLAQGRNV
KSRKLKDIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIKSRRRIILTGTPLQNNL
IEYHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVMKKRAHILYEMLAGCV
QRKDYTALTKFLPPKHEYVLAVRMTAIQCKLYQYYLDHLTGVGNSTEGGRGKAGAKLFQD
FQMLSRIWTHPWCLQLDYISKENKGYFDEDSMDEFIASDSDETSKSLSSDEKKKPKGKKG
KKDSSSSGSGSDNDVEVIKVWNSRSRGGGDGNVDDTGNNPSVSLKLDESKTTSTSNPSSP
APDWYKDFVTDTDAEVLEHSGKMVLLFEILRMAEEIGDKVLVFSQSLISLDLIEDFLELA
SREKTEDKEKPLIYKGEGKWIRNIDYYRLDGSTNAQSRKKWAEEFNDETNVRGRLFIIST
KAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDKIYD
RQVTKQSLSFRVVDQQQVERHFTMNELTELYTFEPDLLDDPNSEKKKKRDTPMLPKDTIL
AELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAEYEAEKKGLTMRFNIPTGTNL
PPVTFTSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSMTAVRIQPLEDIISTV
WKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLINCVQRILMNRRLQQQ
YTQQQQQQLTYQQATLSHLMMPKPPNLIMTPSNYQQIDMRGMYQSVAGGMQPPPLQRAPP
PTVRSKNPGPSPGKSM
NT seq 7431 nt   +upstreamnt  +downstreamnt
atgaccgctgagcccatgagtggaaacaagttgagtacattggtgcagaagcttcatgac
ttcttagcacactcatcagaagaatctgaggaaacgtgttcttctccacgacttgtcatg
aaccaaagcacagataaaatctgtggttctggacttaattctgatatgatggaaaataac
aaggaagagggagctagcacctcagaaaaatccagatcttcaggttcatcaaggtcaaag
aggaaaccttcaattgtgacaaaatatgtagaatctgatgatgaaaaacccacggatgag
aatgtaaatgaaaaagctgctactgagaattcagaaaatgacattactatgcaaagcttg
ccaaaaggtacagtgattgtacaaccagagccagtgctgaatgaagacaaagatgatttt
aaagggcctgaatttagaagcagaagtaaaatgaaagctgacaatctcaaaaaacgcgga
gaagatggacttcatgggatcgtgagctgcacagcttgtggacagcaggtcaatcatttt
caaaaagattccatttatagacacccttcactcaaagtccttatctgtaagaactgcttt
aagtattatatgagtgacgatattagccgtgactcagatggaatggatgaacaatgtaga
tggtgtgcagaaggtgggaacttgatttgttgtgacttttgtcataacgccttctgtaag
aaatgcatcctgcgcaaccttggtcgaaaggagttgtctacaataatggatgaaaacaat
cagtggtattgctatatttgtcaaccagagcctctactggacttggtgactgcgtgcaac
agcgtatttgagaatttagaacagttgttgcaacagaataagaagaagataaaagttgac
agtgaaaagactagtaaagtctgtgaccaaacatccaaattttctccaaagaagagtagt
tctagttgtaatggagaagaaaaaaagttagaggagtcctgttctggttctgtaagctcc
acttactctcactcagcactatctgtgcccaaagagatgattaagaagacaacaaaactg
attgagactacatccaacatgaactccagttacattaagtttctaaaacaggcagcagat
aattcagaaatgacttctgctatgaagttatgtcaacttaagtcttttaaatctgtgttg
gatgatatcaagaaggctcatcttgcattagaagaagatttgaattcagagatccaagct
ttggatgatgtacacaaagaaaaaaataccaaagaccttaaaagcacagatgctaagtct
gaaacaaaattaggaaaaggggaaaaatcctattctacagaaaagagagagtttttaaag
ttagatgctagatcatcagtaaaggccatagatggtgaagagcagagagcacacaaaagt
actagtggggaacataagggttcaggtaggaaagatggctctcagtatgaacccactaac
actcctgaggatttagatatggatattgtgtctgttccttcctcggttccagaagacatt
tttgatagccttgagagtgctatggaagttcagagttcagctgattatcaaggagacggc
aacagtgggactgagccagaactggagagctcctctgtaaaattaaatgtttcttcaaaa
gacagcagaggaaatattaagtcaaaagtcacagcgaaagtaagaaaagaattatttgtt
aaacttaccccagtttccctttctaattccccaattaaaggtgttgactgtcaggaagtg
tcacaagagaagaatggccgtaaaagttctggggtggcccgcagctcagagaaatgtaga
cccagagaggaaattagtgatcatgaaaacaatgtcacaatacttttagaagactccgat
cttcgaagatccccacgtgtaaaaactacaccgttgaggcgacagacagaaagcaaccct
gcaatgtcgaattcagatgaagaaagtaatggaactatgaaggagaaacaaaagatgtca
ggtccaataagaaaaaaggataagagaaactcagctgactgtgctactgataaccctaaa
cctcacaaggtacccaaagctaagcaaccagtgattggggatcagaattcagattctgat
gaaatgctagcagtcctcaaagaggcaagtcagatggggcatagttcttcctcagacact
gacattaatgaaccacagatgaatcataaaggtaaaacagggaaagatgataatggaaaa
aggaaacggaaaaattctacttccgggtcagattttgacactaaaaaaggaaaatcaaca
gaaacctctattatctctaaaaagaaacgccagaactactcagagtcctctaactatgac
tcagagttagagagagagataaaaaccatgagcagaattggggctgccagaaaaagtgtt
ccagagaaaaaagaagaggactcttctgaagatgaaaaacagggcaaaaaagtagtggat
aatggagggcatgagagggcgaagacaacacaagaagggtcatctgctgatgacactggt
gacactgaaggcaggcagggagggagttgctccatagcaggaggttccattgagaaagtc
aggagtggagtggaattccgagagatgctttgcaaacctggtgtttcctctgatggtgct
gaaaagccttcagtgaaagaggagaacgtgaattcccctgaagacaaaagagtctctaag
actaaagaaaagactaaacatctgagaagcagacaaagtagaaaaggaaagggtgggtca
tctgatggcactgatcgatttccaaagaaagagcagagcgatgagtcttctgaaggcgaa
aagaagcagagcagacagagacctggaacaaaaggaaagaaagccccagacttaaaggga
gaaacactgaagcgagagcaggagtgggactcttcctctgatgggaccgagagattgccg
gaggaagaggagattggtcctttttctaaaggcataaagcaaagtaaaactgacacagct
ggtggagaaaagaaaggcaaaaaatggaaagataaatcatgtgaaaagaaggaagaatta
tctgatagtgttgataaattgccaggaaaaggagatagttgtgactcttccgaagataag
aagaccaggaacagagtgtctctgagagagaagaaacgattcagcttgcctgcaaagagt
ccagggaagaggccagagtgttcatcgtcagatactgagaaatccttgaaaggacagtgt
tgtgactccactgaaaagagaccgaaaagaattgacttgagagaaagaagaaactccagt
tcaaagagaaataccaaggaagtaaagagtgcttcatcctcttctgatgctgagggaagc
tcagaagataataaaaagcagaagaaacaaagaacttcagccaaaaagaagacaggcaat
acgaaggagaaaaaaagaaactccttaagagcaactcctaaaaggaagcaagtagacatc
acttcttcatcttctgatataggagatgatgatcagaattctgcaggcgaggaaagcagc
gatgaacagaaaatcaaacccgtgactgaaaatctagtgctgccttcacacactggattt
tgtcagtcttcaggagatgaagccttatctaaatcagtgcctgccacagtggatgatgac
gacgacgacaatgatcctgaaaatagaattgccaagaagatgcttttagaagaaattaaa
gccaatctttcctctgatgaggatgggtcgtcagatgatgaacctgatggaggagggaaa
aaaagaattgggaaacagagtgaagaatctccagcagatgatggtgaactccgcagagag
cagttagccgtgaatcaagtcaactctgaatccgactctgattctgaagaatctaagaag
ccaagatacagacataggcttttgaggcataaactgactttgagtgatggagaatctgga
gaagaaaaacctactaagcctaaagagcataaagaagccaaaggaagaaatagaaggaag
gtgagcagtgaggattcagaagacaccgactttcaggagtcaggagttagcgaagaagtc
agtgaatctgaggatgaacagcggcctagaacacggtctgcaaagaaagcagaattggaa
gaaaatcagcggagttataaacagaagaagaaaagacggcgcattaaggttcaagaggat
tcctccagtgaaaataagagccattctgaggaggacaagaaggaaggtgatgaggaggac
gaggaggacgaggacgaagacgaggaagatgaaaatgatgattccaagtcacctggaaaa
ggcagaaagaaaattcggaagattcttaaagatgataaactaagaacagaaacacagaat
gcccttaaagaagaggaagaaaggcgaaaacgtattgcagagagggaacgtgaaagggag
aaattgagagaggtgatagaaattgaggatgcttcacctactaagtgtccaataacaacc
aaattggttttagatgaaaatgaagagaccaaagaaccgttagtgcaggttcatagaaac
atggttataaaattgaaaccccatcaagtagatggtgttcagtttatgtgggattgctgc
tgtgagtctgtggaaaagacaaagaagtccccaggttcaggatgtattcttgcccactgc
atgggccttggtaagaccctccaggtggttagttttcttcacacagttcttctgtgtgac
aaattggatttcagtacagctttagtggtttgtcctcttaacactgctttgaattggatg
aatgaatttgagaagtggcaggagggattaaatgataatgaaaaacttgaggtatctgag
ttagcaactgtgaaacgtcctcaggagagaagttatatgctacagagatggcaagaagat
ggtggtgttatgatcatagggtatgaaatgtacagaaatctcgctcaaggaagaaatgtg
aaaagtcggaaacttaaagacatatttaataaagctttagttgacccaggccctgatttt
gttgtttgtgatgaaggccatattctaaaaaatgaagcatctgctgtttcaaaagctatg
aactctataaaatcaaggaggaggattattttaacaggaacaccacttcaaaataaccta
attgaatatcattgcatggttaactttatcaaggaaaatttgcttggatccatcaaggaa
ttcaggaatagatttataaatccaatccaaaatggacagtgtgcagattctaccatggta
gatgtgagagtgatgaaaaaacgtgctcatattctctatgagatgttagccggatgtgtt
cagaggaaagattacacagcgctaacaaagttcttacctccaaaacatgagtatgtgtta
gctgtgagaatgactgctattcagtgcaagctctatcaatactacttagatcacttaaca
ggtgtgggcaatagcactgaaggtggaagaggaaaggcaggtgcaaagctttttcaagat
ttccaaatgttaagtagaatctggactcatccttggtgtttgcaactggactatatcagc
aaagaaaataagggttattttgatgaagatagtatggatgaatttatagcttcagattct
gatgaaacctctaagagtttaagctcagatgaaaagaagaaaccaaaggggaagaagggg
aaaaaggacagcagctcaagcggaagtggcagtgacaacgatgttgaagtcatcaaagtc
tggaattcaagatctcgaggaggtggagatggcaacgtggatgacacaggaaataaccct
tcagtttctctgaagctagatgaaagtaaaactacttccacttctaacccaagtagccca
gctccagattggtacaaagattttgttacagatactgatgctgaggttttagaacattct
ggaaaaatggtgcttctttttgaaattcttcgaatggcagaagaaattggggataaagtt
cttgtttttagccagtcgctcatatctctggacttgattgaagattttcttgaattggct
agtagggagaaaacagaagataaagaaaaacctcttatttataaaggtgaaggaaagtgg
atccgaaatattgactattaccgcttggatggttctactaatgcacagtcaaggaagaag
tgggctgaagaatttaatgatgaaaccaatgtgagagggcgattgtttatcatttccact
aaagcaggatctcttggaattaacctggtagctgctaatagagtgattatatttgatgct
tcttggaatccatcttatgacatccagagtatattcagagtttatcgctttggacaaact
aagcctgtttatgtatataggttcttagctcagggaaccatggaagataagatttatgat
cgtcaggtaacaaagcagtcactgtctttccgcgttgtggatcaacagcaggttgagcgc
cattttaccatgaatgagcttactgaactttatacttttgagccagacttactagatgac
ccgaattcagaaaagaagaagaaaagggatacccccatgctgccaaaggataccatactt
gcagaacttcttcagatacataaagagcacattgtgggctatcatgaacatgattctctt
ttggatcacaaagaagaagaagaactaactgaagaagaaagaaaagcagcttgggctgaa
tatgaagcagaaaagaagggactgaccatgcgtttcaacataccaactgggaccaattta
ccccctgtcactttcacctctcaaactccttatattcctttcaatttgggagccctgtcc
gcaatgagtaatcagcagctggaggaccttattaatcaaggaagagaaaaagttgtagaa
gccacgaacagtatgacggcagtgaggattcagcctcttgaagacatcatttcaactgta
tggaaagaaaacatgaatctctctgaggcccaagtccaagcactagcattaagtagacaa
gccagccaggagcttgacgtgaaacgaagagaagcaatctacaacgatgtattgacaaag
caacagatgttgatcaactgtgttcagcgaatacttatgaatagacggctccagcagcag
tacactcagcagcaacagcaacaattgacttatcagcaagcaacactgagtcacctcatg
atgccaaagcctccaaatttaatcatgactccttctaactaccagcagattgatatgaga
ggaatgtatcagtcagtggctggtggtatgcagccaccacccttacagcgtgcaccgccc
cccacagtgagaagcaaaaatccaggaccttccccagggaaatcaatgtga

DBGET integrated database retrieval system