KEGG   Mus musculus (house mouse): 225895
Entry
225895            CDS       T01002                                 
Symbol
Taf6l, 2810417N14Rik, BB223262, C530024J06Rik, Paf65a
Name
(RefSeq) TATA-box binding protein associated factor 6 like
  KO
K03131  transcription initiation factor TFIID subunit 6
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    225895 (Taf6l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    225895 (Taf6l)
   03036 Chromosome and associated proteins [BR:mmu03036]
    225895 (Taf6l)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     225895 (Taf6l)
   Coactivators
    SAGA/TFTC/STAGA complex
     225895 (Taf6l)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     225895 (Taf6l)
    STAGA complex
     225895 (Taf6l)
    TFTC complex
     225895 (Taf6l)
    SAGA complex
     225895 (Taf6l)
    SLIK complex
     225895 (Taf6l)
SSDB
Motif
Pfam: TAF TAF6_C
Other DBs
NCBI-GeneID: 225895
NCBI-ProteinID: NP_666204
MGI: 2444957
Ensembl: ENSMUSG00000003680
UniProt: Q8R2K4 H3BK01
Position
19:complement(8751718..8763781)
AA seq 623 aa
MQSSTGAMSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQ
FMKHTKRRKLTVEDFNRALRWSSVEAVCGYGSQEALPLRPAREGDLYFPEDREVSLVELA
LATNIPKGCAETAVRVHVSYLDGKGNLAPQGSVPSAVSSLTDDLLKYYQQVTRAVLGDDP
QLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLIRNPHLCLGP
YVRSLVGSVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQQILLSL
QKVLTDPVRPLCSHYGAVVGLHALGWKAVERVLYPHLPTYWTNLQAVLDDYSVSNAQVKA
DGHKVYGAILVAVERLLKMKAQAAEPNRGGLGGRGYRPAEDLPWDSLLLQESPPGGSSET
GFGSGLPPPSGVAGPEDPSSLTLADIYRELYSFFGDSLATRFGTGQPAPTAPRPPGDKKE
PAAAPDSVRKMPQLTASAVVSPQGDESPCGGTLATATAASESRPLPRVHRARGAPRQQGP
GAGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLP
MIGRTGRPARRWALSDYSLYLPL
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgcaaagttccaccggggccatgtcagaacgagaggagaggaggtttgtggagatccct
cgggagtcggtccggctcatggcagagagcacaggtctagagctgagtgacgaggtggcc
gctctgctcgctgaagatgtgtgctaccgtctccgagaggccacacagaatagctctcaa
ttcatgaaacacaccaaacgaaggaagctgacggtggaggacttcaacagggctctcagg
tggagcagcgtggaggctgtgtgtggctatgggtcccaggaggcattgcccttgcgccct
gcaagggagggtgatctctacttcccggaggatcgagaagtgagcctggtggagctggca
ctagccaccaacatccccaagggctgtgcagagacagctgtcagagttcatgtctcctat
ctggatggcaaaggaaacctggcacctcagggatcagtgcccagtgcagtgtcttcactg
acagatgacctgctcaaatactaccagcaagtgacacgggctgtactgggagatgaccca
cagctgatgaaggttgccctccaggacctccagacaaactccaagattgcagcactcctg
ccttactttgtttatgtggtcagtggggtaaaatctgtaagccacgacctggaacaactg
caccgactactgcaggtggcaaggagcctgatacggaacccacacctgtgcttgggaccc
tatgtccgatccttggtgggcagcgtgctttactgtgtcttggagccactggccgcctcc
atcaaccctttgaatgaccactggactctgcgagatggggctgcccttctactcagtcac
atattctggacgcatggagaccttgtaagtggcctgtatcagcagattctgctgtccctg
cagaaggtcctgacagaccctgttcggcctctctgttctcactatggggcagtggtgggg
ctgcatgctctaggctggaaggcagtggagcgagtcctctacccacatctgcccacttac
tggacaaacttgcaggctgtgctggatgactattccgtatctaatgcccaggtcaaagcg
gacgggcacaaagtgtatggagccattctggtggccgtagaacgactattgaagatgaaa
gctcaggcagcagagcccaaccgcggtggccttggcgggagagggtaccgtcctgcggag
gacctgccttgggacagccttctcctacaagaatctccccccgggggcagctccgaaaca
ggttttgggtctggtctcccgccaccatcaggggttgcgggaccagaggacccttcttcc
ttgaccctggcagacatctaccgtgagctatactccttctttggtgacagcttggccact
cgctttggcactggccagcctgctcccacggccccgcgaccacccggagacaagaaggag
cctgcggctgccccggattcggtgcggaaaatgccgcagctgactgccagcgccgtggtc
agccctcagggtgacgaaagcccgtgcggtgggactctcgccaccgccaccgccgcctcg
gagagcaggccgctaccgcgcgtacaccgggcgcggggtgctcctcgtcagcagggcccc
ggcgcgggaacgcgagacgtcttccagaagagccgcttcgcgccccgtggcgccccacac
ttccggtttataatcgcagggcgtcaggccgggcggcgctgccgcgggcgcctctttcaa
actgcctttcctgccccatatgggcccagccccgcgtcccgctacgtgcagaagctgccc
atgatcggccgtaccggccgcccggcccgccgctgggcgctctccgactactcgctgtac
ctgccgctgtga

DBGET integrated database retrieval system