KEGG   Mus musculus (mouse): 22590Help
Entry
22590             CDS       T01002                                 

Gene name
Xpa, AI573865, Xpac
Definition
(RefSeq) xeroderma pigmentosum, complementation group A
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    22590 (Xpa)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    22590 (Xpa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22590 (Xpa)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     22590 (Xpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPA_C XPA_N zf_C2H2_13 Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 22590
NCBI-ProteinID: NP_035858
MGI: 99135
Ensembl: ENSMUSG00000028329
Vega: OTTMUSG00000006889
UniProt: Q64267
Position
4 B1; 4 24.49 cM
AA seq 272 aa AA seqDB search
MATAEEKQTSPEPVAADEPAQLPAAVRASVERKRQRALMLRQARLAARPYPAAAATGGVA
SVKAAPKMIDTKGGFILEEEEEKHEIGNIVHEPGPVMEFDYTICEECGKEFMDSYLMNHF
DLPTCDSCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALRFLVKKNPRHSQWGDMKLY
LKLQVVKRALEVWGSQEALEDAKEVRQENREKMKQKKFDKKVKELRRAIRSSVWKRETTT
HQHKYGPEENLEDDMYRKTCTLCGHELTYEKM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggccgaggaaaagcagacgtcacctgagcccgtggccgcggacgagcccgcg
cagctgccggccgccgtacgcgcgagcgtggagcggaagcgacagcgggcactgatgctg
cgccaggctcggctggctgcgcggccctaccccgcggcggcggccaccggaggcgtggcc
agtgtaaaagcagctcccaaaatgattgacaccaaaggtggcttcattttagaagaggaa
gaagagaaacacgagattggaaacattgttcatgaaccagggcccgtcatggagtttgat
tacaccatctgtgaagaatgcgggaaagagttcatggactcgtaccttatgaaccacttt
gatctgccaacgtgtgacagctgcagagatgctgatgataaacacaagcttataaccaag
acagaagcgaagcaagagtaccttctgaaggactgtgatctagagaagagagagccagcg
ctcaggttccttgtgaagaagaacccacgccattcacagtggggcgatatgaagctctac
ctaaagctacaggtggtaaagcgggctcttgaagtgtggggtagccaggaagctctggaa
gatgcaaaggaagtgaggcaggaaaaccgagaaaaaatgaagcagaagaagtttgataaa
aaagtaaaagaattgcggcgagcaataagaagcagtgtatggaaaagagagacaaccact
caccaacataaatatggaccagaggaaaacttagaagatgacatgtaccgcaagacttgt
accttgtgtggccacgaactgacatatgaaaaaatgtga

DBGET integrated database retrieval system