KEGG   Mus musculus (mouse): 225912Help
Entry
225912            CDS       T01002                                 

Gene name
Cyb561a3, 2310004G04Rik, Cybasc3, Lcytb
Definition
(RefSeq) cytochrome b561 family, member A3
  KO
K16295  cytochrome b ascorbate-dependent protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    225912 (Cyb561a3)
Transporters [BR:mmu02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   225912 (Cyb561a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_B561
Motif
Other DBs
NCBI-GeneID: 225912
NCBI-ProteinID: NP_001268993
MGI: 2686925
Ensembl: ENSMUSG00000034445
UniProt: Q6P1H1
Position
19; 19 A
AA seq 242 aa AA seqDB search
MASGWFYLSCMVLGSLGSMCILFTAYWMQYWRGGFAWDGTVLMFNWHPVLMVAGMVVLYG
AASLVYRLPSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWL
GITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLHVFFGACILSLSITSVISGINEKLF
FVLKNATKPYSSLPGEAVFANSTGLLVVAFGLLVLYVLLASSWKRPDPGALTDRQPLLHD
RE
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggatggttttacctgtcctgcatggtgctgggatcgctgggatcgatgtgc
atcctcttcactgcctactggatgcagtactggcgcggtggctttgcctgggatggcacg
gtgctcatgtttaactggcacccagtgctcatggttgccggcatggtggtgctctatgga
gctgcctcactggtgtaccgcctgccttcatcgtgggtggggcccaggctgccctggaaa
gttctccatgcagcactgcacctgctggccttcacctgcactgtggtggggctgattgcc
gtctttcggtttcacaaccactcgagaatcgcacacctctactccctgcacagctggctg
ggtatcaccactgtagtcctcttcgcctgccagtggttcctgggctttgctgtcttcctc
ctgccctgggcatcccagtggctgcgaagcctcctgaaacctctgcatgtattctttgga
gcctgcatcctttccctgtccatcacatctgttatttccggcatcaatgagaagcttttc
tttgttttgaaaaatgccaccaagccctactccagcctgcctggtgaggctgtctttgcc
aacagcacagggctcttggtggtggcttttggcttgctggttctctatgttcttctggct
tcatcatggaagcgtccagatccaggagctctgactgatagacagcccctgttgcatgac
agggaatga

DBGET integrated database retrieval system