KEGG   Mus musculus (mouse): 225913
Entry
225913            CDS       T01002                                 

Gene name
Tkfc, BC021917, Da, Dak
Definition
(RefSeq) triokinase, FMN cyclase
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00051  Fructose and mannose metabolism
mmu00561  Glycerolipid metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    225913 (Tkfc)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    225913 (Tkfc)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    225913 (Tkfc)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     225913 (Tkfc)
    2.7.1.29  glycerone kinase
     225913 (Tkfc)
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     225913 (Tkfc)
SSDB
Motif
Pfam: Dak1 Dak2
Other DBs
NCBI-GeneID: 225913
NCBI-ProteinID: NP_663471
MGI: 2385084
Ensembl: ENSMUSG00000034371
UniProt: Q8VC30
Position
19; 19 A
AA seq 578 aa
MSSKKMVNSVEGCADDALAGLVASNPDLQLLQGHRVALRSDLDTLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGSVFASPPVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGL
AMEQAKAEGISVEMVIVEDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEEGMGLEEITKR
VSVIAKTMGTLGVSLSSCSVPGATHTFELAADEIELGLGIHGEAGVRRIKIAPVDQIVTL
MLDHMTNTSNIFHVPVRSGSSVVLIVNNLGGLSFLELGIIADAAIRLLEGRGVKVARALV
GTFMSALEMPGVSLTLMLVDEPVLKLIDAETTAKAWPHMAKVSVTGRKRIRAAPTEPPEA
PEATAAGGVTSKQMALVLDRICTTLIGLEEHLNALDRAAGDGDCGSTHSRAAKAIQGWLK
EGPSLTSPAQVLSRLSVLLLERMGGSSGALYGLFLTAAAQPLKAKTDLPTWSAAMDAGLE
SMQKYGKAAPGDRTMLDSLWAAAQEFQAWKSPGASLLPVLTKAVKSAEAAAEATKNMEAG
AGRASYISSAQLDQPDPGAVAAAAIFRAILEVLQTQGA
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgagttccaagaagatggtgaattctgtggaagggtgtgctgatgatgcccttgctggg
ttagtagcctctaaccctgacttgcagctcctgcaagggcaccgtgtggccctacgttct
gacctggacaccctcaagggccgggtagcacttctgtcaggtggaggctcaggccatgag
cctgcccatgccggttttatcgggaaagggatgctaacaggtgtcatcgcaggatctgtg
tttgcctctcctcctgtgggcagcatcctggcagccattagagctgtggcccaggcaggc
acagtgggcaccctcctcattgtgaagaactacactggggatcggctcaactttggactt
gccatggagcaggccaaggccgagggcatctctgtggagatggtgatagttgaggatgac
agtgccttcaccgtcctcaagaaggcaggccggcgtggcctgtgtggcacagtacttatc
cacaaggtggcaggtgctctggctgaggaaggaatggggctggaggagatcacaaagagg
gtgagcgtgatcgccaagaccatgggtaccctaggggtgagcttgtcatcctgcagtgtc
cctggcgccacacacacctttgagcttgcagctgatgaaatagagctaggcctggggatc
catggggaagctggtgttcgtcggataaagatagcacctgttgatcagattgtcactctt
atgcttgaccacatgacaaacacctccaatatatttcatgtgcctgtacggtcaggctct
tcagtggtgctgatagtcaacaatctgggtggcctgtctttcctggaactgggcatcata
gctgatgctgccatacgcttgctggagggccgtggagtgaaggtcgcccgtgccctggtg
ggcaccttcatgtcagcgctggagatgcctggtgtgtctcttactttgatgcttgtggat
gaacccgtgctgaagctaatagatgctgaaactactgcaaaagcctggcctcacatggcc
aaggtctctgtgactgggaggaagcggattcgggcagctcccacagagcctccagaagcc
cctgaagccactgcagcaggaggtgtaacatcaaagcagatggcacttgtgctggatcgg
atatgcaccaccctcatcggactggaggagcacctgaatgccttggacagggctgctggt
gatggggattgtggttctacccatagccgtgctgccaaagccattcagggctggctaaag
gaaggcccatctctaaccagccctgcccaggtactctccagattgtctgtcctgctgctg
gagaggatgggaggctcatctggggcgctctatggcctgttcctgactgcagctgcccag
cctctcaaggccaagactgacctcccaacctggtctgctgccatggatgccggcttagag
tccatgcagaagtatggaaaggctgcaccaggagacaggacaatgctggattctctgtgg
gcagcagcacaggagttccaagcctggaagagcccaggggccagtctcctcccagtcctg
actaaagcagtcaagagtgctgaagctgcagccgaggccaccaagaatatggaagctggt
gctgggagagctagttatatcagctctgcacaactagatcagccagaccctggagcagtc
gcagctgctgccatcttccgtgccatcctggaggtcttgcagacgcagggagcatga

DBGET integrated database retrieval system