KEGG   Mus musculus (mouse): 22592Help
Entry
22592             CDS       T01002                                 

Gene name
Ercc5, Xpg
Definition
(RefSeq) excision repair cross-complementing rodent repair deficiency, complementation group 5
  KO
K10846  DNA excision repair protein ERCC-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    22592 (Ercc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22592 (Ercc5)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     22592 (Ercc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 22592
NCBI-ProteinID: NP_035859
MGI: 103582
Ensembl: ENSMUSG00000026048
Vega: OTTMUSG00000021431
UniProt: E9QM61 Q3UV64
Position
1 C1.1; 1 23.55 cM
AA seq 1170 aa AA seqDB search
MGVQGLWKLLECSGHRVSPEALEGKVLAVDISIWLNQALKGVRDSHGNVIENAHLLTLFH
RLCKLLFFRIRPIFVFDGDAPLLKKQTLAKRRQRKDSASIDSRKTTEKLLKTFLKRQALK
TAFRSSRHEAPPSLTQVQRQDDIYVLPPLPEEEKHSSEEEDEKQWQARMDQKQALQEEFF
HNPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESNDFSQYQLKGLLKK
NYLNQHIENVQKEMNQQHSGQIQRQYQDEGGFLKEVESRRVVSEDTSHYILIKGIQGKKV
MDVDSESLPSSSNVHSVSSNLKSSPHEKVKPEREPEAAPPSPRTLLAIQAAMLGSSSEDE
PESREGRQSKERNSGATADAGSISPRTCAAIQKALDDDNDEKVSGSSDDLAEKMLLGSGL
EQEEHADETAERGGGVPFDTAPLTPSVTEVKECVTSGSSANGQTDSAHSFTTASHRCDTP
KETVSLARAVKEASQISSECEVEGRPAALSPAFIGTPSSHVSGVLSEREPTLAPPTTRTH
SDQGIDIHPEDPELQNGLYPLETKCNSSRLSSDDETEGGQNPAPKACSTVHVPAEAMSNL
ENALPSNAEERGDFQETIQLREVPEAAARELISAPKPMGPMEMESEESESDGSFIEVQSV
VSNSELQTESSEASTHLSEKDAEEPRETLEEGTSRDTECLLQDSSDIEAMEGHREADIDA
EDMPNEWQDINLEELDALESNLLAEQNSLKAQKQQQDRIAASVTGQMFLESQELLRLFGV
PYIQAPMEAEAQCAMLDLTDQTSGTITDDSDIWLFGARHVYKNFFNKNKFVEYYQYVDFY
SQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGRGLDPLLKFSEWWHEAQN
NKKVAENPYDTKVKKKLRKLQLTPGFPNPAVADAYLRPVVDDSRGSFLWGKPDVDKIREF
CQRYFGWNRMKTDESLYPVLKHLNAHQTQLRIDSFFRLAQQEKQDAKLIKSHRLNRAVTC
ILRKEREEKAPELTKVTEALDDAKGKTQKRELPYKKETSVPKRRRPSGNGGFLGDPYCSE
SPQESSCEDGEGSSVMSARQRSAAESSKISCSDVPDLVRDPPHGRQGCVSTSSSSEDDED
KAKTVLVTARPVFGKKKLKLKSMKRRKKKT
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgcaggggctgtggaagctgctggagtgctcgggccaccgggtcagcccggag
gcgctggagggcaaggtgctggccgtggatattagcatttggctaaaccaagcacttaaa
ggagtccgagatagccatgggaatgtgatagaaaatgctcatcttctcacattattccac
cggctctgcaaactcttgttttttcgtatccgccctatttttgtatttgatggtgatgct
ccgctgctaaagaaacagaccttggcaaagagaaggcagaggaaggattctgcatccatt
gactcgagaaaaaccaccgagaaacttctgaaaacctttctgaagagacaggctctgaaa
actgctttcagaagctcaagacatgaagcgccacccagtctcactcaggttcaaagacag
gatgacatctatgttttgccacctttaccagaggaagaaaaacacagttcagaagaggaa
gatgaaaagcaatggcaagcaagaatggatcaaaaacaagcattgcaggaagaattcttt
cataatcctcaggccatagatatcgagtctgaggacttcagcagcctgcctcctgaagta
aagcatgagatcttgactgacatgaaagagtttaccaagcgaaggcgaacactgtttgaa
gcaatgccagaggagtctaatgacttttcacagtaccagctgaaaggcttgctgaagaag
aactacctaaaccagcacatagaaaatgtccaaaaggaaatgaaccagcagcattcaggg
caaatccagaggcaatatcaagatgagggaggctttctgaaggaagtggagtccaggaga
gtggtctctgaagacacctcacattacatcttgataaaaggtattcaaggtaagaaagtc
atggatgtggattcagaatctcttccttcctccagcaacgtacacagtgtgtcttccaac
ctgaagtcatcaccccacgagaaagtgaagccggagagagagccagaggccgcgcctcct
tctccaagaactctactggctattcaggcagccatgctgggaagtagctcagaagatgag
ccagagagtagagagggaaggcagtctaaggagaggaactcaggggccactgcagatgca
ggttccatctcaccccggacctgtgcagctattcagaaagctctggatgatgataacgat
gagaaagtgtctggcagcagtgatgatctagcagagaaaatgctgcttggaagtgggctg
gagcaggaggagcatgctgatgaaacggcagaaagaggtggaggcgtgccatttgacaca
gcgcctctcacacccagtgtgactgaggtaaaggagtgtgtaaccagtggcagcagtgca
aacggacagacagactcagctcattcatttacaaccgcgagtcaccgatgtgatactcca
aaagaaacagtgtctcttgctcgtgccgtgaaagaagcatctcagataagcagtgaatgt
gaggtggagggtaggccagctgccctctcaccagcattcataggaactccaagcagtcat
gtctctggagtcctcagtgaaagggaacccaccctggcacctccgacgacaagaacacat
tctgatcaggggatagacatacaccctgaagatcctgagctacaaaacggactctaccca
cttgagaccaagtgtaattcctctcgcctttcaagtgacgatgaaacagaaggtgggcaa
aaccctgctcccaaagcatgtagtacagttcatgtccctgcagaggcaatgagtaactta
gaaaatgcgttgccttctaatgctgaagaacgtggagatttccaggaaaccatccagcta
cgggaggtgcctgaggctgctgccagggagctgatttcagctccaaagcccatgggacca
atggagatggagtctgaagaaagcgagtctgatggaagtttcattgaggtgcagagtgtg
gtcagcaatagtgaacttcaaacagagtcatccgaggcttctacacatctctctgaaaaa
gatgcagaggaaccaagagaaactctggaggaaggaacctccagggacacagagtgcctc
ctacaggacagctctgacattgaggcaatggaaggacacagagaagctgacatagatgct
gaggacatgcccaacgaatggcaagatattaatttggaggaactggatgccctggaaagt
aacctcttagcagaacagaattcactgaaagcgcaaaaacagcagcaagatcggattgct
gcctctgtaacaggccagatgtttctggaaagccaggaactcctgcgcctgtttggcgtt
ccctacatccaggctcccatggaggcagaggcacagtgtgccatgttggacctcactgac
cagacttctggaacgattactgacgatagtgatatctggctgtttggggcccggcatgtc
tataagaatttttttaacaaaaacaagtttgtagagtactatcaatatgtggacttttac
agtcaactaggactggaccgtaacaagctaatcaacttggcctatctactgggcagtgac
tatacggaagggataccaactgtaggctgtgtaacagccatggagattctcaatgaattc
cctggacgaggcctggacccactcctaaaattctcagagtggtggcacgaagctcaaaat
aacaagaaggttgcagaaaatccctatgacaccaaagtgaaaaaaaaattacggaagttg
cagctgacacctggtttccccaacccggcagttgcagatgcttacctcaggcctgtggtg
gatgactccaggggatcgttcctgtggggcaagcctgatgtggacaagattagagaattt
tgtcagaggtattttggctggaacaggatgaagaccgatgaatccctgtatccagtacta
aagcacctgaatgcccatcagacccagctccggattgattccttttttagactagctcag
caggaaaaacaagatgccaaactcataaagagtcataggctaaacagagcagtgacatgt
atactgaggaaagaacgggaagagaaagctcctgagctgacaaaagtgactgaggccctg
gatgatgcaaaaggaaaaacccagaaaagagagctaccatataaaaaagagacttcagtt
ccaaaaagaaggagaccttcaggcaatggtgggtttctaggggacccctactgctcagaa
tcaccccaggaatcttcctgtgaggatggagaaggttcatctgtgatgagtgcacgacag
agaagtgcagctgagtcgtcaaaaatcagctgctcagatgtgcctgacttagtgagagac
cctcctcatgggaggcaaggctgtgtgtccactagtagctccagcgaggatgatgaggac
aaagccaagactgtcctagtgactgctagacctgtatttgggaagaaaaaactgaaacta
aagagtatgaagagaaggaaaaagaaaacctaa

DBGET integrated database retrieval system