KEGG   Mus musculus (mouse): 22594Help
Entry
22594             CDS       T01002                                 

Gene name
Xrcc1, Xrcc-1
Definition
(RefSeq) X-ray repair complementing defective repair in Chinese hamster cells 1
  KO
K10803  DNA-repair protein XRCC1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    22594 (Xrcc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22594 (Xrcc1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     22594 (Xrcc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XRCC1_N BRCT BRCT_2 PTCB-BRCT LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 22594
NCBI-ProteinID: NP_033558
MGI: 99137
Ensembl: ENSMUSG00000051768
Vega: OTTMUSG00000058221
UniProt: Q60596 Q3TGI0
Structure
PDB: 

Position
7 A3; 7 11.42 cM
AA seq 631 aa AA seqDB search
MPEISLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGATAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRIFGPDKLVR
AAAEKRWDRVKIVCSQPYSKDSPYGLSFVKFHSPPDKDEAEATSQKVTVTKLGQFRVKEE
DDSANSLKPGALFFSRINKTSSASTSDPAGPSYAAATLQASSAASSASPVPKVVGSSSKP
QEPPKGKRKLDLSLEDRKPPSKPSAGPSTLKRPKLSVPSRTPAAAPASTPAQRAVPGKPR
GEGTEPRGARTGPQELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTPDSTHL
ICAFANTPKYSQVLGLGGRIVRKEWVLDCHHMRRRLPSRRYLMAGLGSSSEDEGDSHSES
GEDEAPKLPQKRPQPKAKTQAAGPSSPPRPPTPKETKAPSPGPQDNSDTEGEESEGRDNG
AEDSGDTEDELRRVAKQREQRQPPAPEENGEDPYAGSTDENTDSETPSEADLPIPELPDF
FEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDYMNERVQFVITAQEWDPNFEEALMENP
SLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatcagcctccgccacgtcgtgtcctgcagcagccaggactcgacccattgt
gccgaaaatcttctcaaggcggacacttaccggaagtggcgggcagccaaggcaggagag
aagaccatctctgtggtcctacagttggagaaggaggagcagatccacagtgtggacatt
ggcaatgatggctcggcctttgtggaggtgctagtgggcagctcggctggaggggccaca
gctggtgaacaggactatgaggtccttctggtcacctcctctttcatgtccccctctgag
agccgaagtggctcaaatcccaaccgtgttcgcatttttggacctgacaagttagtccgg
gcagcagcggagaagcgctgggaccgtgttaaaattgtgtgcagccagccatacagcaag
gactcgccatacggcctgagttttgtgaagtttcacagccctcctgacaaagatgaggca
gaggctacatctcagaaggtgacagtgaccaagctcggccagtttcgtgtgaaagaggag
gatgacagtgccaactccctgaagccaggggctctcttcttcagtcgtatcaacaagacg
tcatcagcctctacgagtgacccagcaggacccagctatgcagcagctacactgcaggcc
tctagtgcagcctcctcagcctctccagtccccaaggttgtgggcagctcttccaagcct
caggagcctcccaaagggaagagaaaactggacttgagtctagaagacaggaaacctccc
agcaaaccctcggcagggccatccaccctcaagagacccaaattgtctgtccctagtcgt
actccagctgcagctccagcctctaccccagcacagagagccgtcccagggaagccccgg
ggagaaggcacagagcctaggggggctcgcactggaccccaagagcttggcaagatcctg
caaggggtggtggtggtgctcagtggcttccagaaccccttccgctcagagctccgggac
aaggccctggaactgggggccaagtatcggccagactggaccccagacagcacacatctc
atctgtgcctttgccaacactcccaaatacagccaggtcctgggccttggaggccggatt
gtgcgtaaagagtgggtgctggactgtcaccacatgcggcgccggctgccctcccggagg
tacctcatggcaggccttggatccagcagtgaggacgaaggggactctcacagtgagagc
ggcgaagacgaagctcccaagcttccccaaaagcggccccagcccaaagccaagacccag
gcagcaggacccagctcacccccgaggccaccaaccccaaaagagaccaaagcaccgtca
ccaggaccccaggacaatagtgacactgagggggaagagtcagaaggacgggacaacggg
gcagaagattctggggacaccgaggatgaactgaggagggtggccaaacagagggaacaa
aggcagcccccagccccagaggagaatggcgaggacccgtatgcaggctccacagatgag
aacacagacagtgagaccccctcagaggctgacctgccaatcccagagctcccagacttc
ttcgagggcaaacacttcttcctgtatggcgagttccctggggatgagaggaggaggctc
atccgctacgtgaccgctttcaatggcgagctcgaggactatatgaatgagcgggtccag
ttcgtcatcacggcccaggagtgggaccccaactttgaggaggccctgatggaaaaccct
tccctggccttcgtgcggccccggtggatctacagttgtaatgagaagcagaagttactc
ccccatcagctctatggggtggtgccccaggcctga

DBGET integrated database retrieval system