KEGG   Mus musculus (house mouse): 225998
Entry
225998            CDS       T01002                                 
Symbol
Rorb, Nr1f2, RZR-beta, RZRB, Rorbeta, hstp
Name
(RefSeq) RAR-related orphan receptor beta
  KO
K08533  RAR-related orphan receptor beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    225998 (Rorb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    225998 (Rorb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    225998 (Rorb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    225998 (Rorb)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   225998 (Rorb)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 225998
NCBI-ProteinID: NP_666207
MGI: 1343464
Ensembl: ENSMUSG00000036192
Vega: OTTMUSG00000023329
UniProt: Q8R1B8
Position
19:complement(18907966..19088560)
AA seq 470 aa
MCENQPKTKADGTAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNTETGGTYANGHVIDLPKSEGYYSIDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMSEIDRIAQNIIKSHLETCQY
TMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELFNPDCAAVCK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtgtgagaaccagcccaaaactaaagctgacggcactgcacaaattgaagtgatacca
tgcaaaatttgtggcgataaatcctccgggatccactacggagtcatcacgtgtgaaggc
tgcaagggattcttcaggaggagccagcagaacaatgcctcttactcctgcccaaggcag
agaaactgtttaattgacagaaccaacaggaaccgttgccaacactgccgcctgcagaag
tgtcttgccctaggaatgtcaagagatgctgtaaagttcgggaggatgtccaagaagcag
cgggacagcctgtatgctgaggtgcagaagcatcagcaaaggctgcaggagcagcggcag
cagcagagtggggaggcggaggccctcgccagggtgtacagcagcagcattagcaatggc
ctcagcaacctgaacaccgagaccggcggcacatacgccaacgggcacgtcattgacctg
cccaagtccgaaggttattacagcatagattccggtcagccgtctcccgatcagtcagga
ctggacatgactgggatcaaacagataaagcaagaacctatctatgacctcacatctgta
cccaacttgtttacctatagctctttcaacaacgggcagttagctcccgggataacaatg
tctgagatcgatcgaattgcacagaacatcattaagtcccatttggagacatgtcagtac
accatggaagaactccatcagctggcatggcagacccacacctacgaggaaatcaaggcg
tatcaaagcaagtccagggaggctctgtggcagcagtgtgccatccagatcacccatgct
atccagtacgtggtggagttcgccaagcggataacaggcttcatggagctgtgtcagaac
gatcagatcttacttctgaagtcaggttgcttggaagtggttttagtgagaatgtgtcgt
gccttcaacccattaaacaacactgttctgtttgaaggaaaatatggaggaatgcaaatg
ttcaaagccttaggttcggatgacctagtgaatgaagcatttgactttgcgaagaatctg
tgttccttgcagctgactgaggaagagattgctctgttctcctctgctgttctgatatcc
ccagaccgagcctggctgatcgaaccaagaaaagtccagaagcttcaggaaaagatttat
tttgcactgcaacatgtgattcagaagaaccacctggatgatgagaccctggcaaagtta
atagccaagataccaactatcacggcagtctgcaacttgcatggggagaagctgcaggta
tttaagcagtctcatccagacatagtgaatacactgtttcctccattgtacaaggagctc
tttaatcctgactgtgctgcggtctgcaaatga

DBGET integrated database retrieval system