KEGG   Mus musculus (mouse): 22601
Entry
22601             CDS       T01002                                 

Gene name
Yap1, AI325207, Y, Yap, Yap65, Yk, Yki, Yorkie, yor
Definition
(RefSeq) yes-associated protein 1
  KO
K16687  transcriptional coactivator YAP1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    22601 (Yap1)
   04392 Hippo signaling pathway - multiple species
    22601 (Yap1)
Motif
Pfam: WW FAM181 DUF3652
Other DBs
NCBI-GeneID: 22601
NCBI-ProteinID: NP_001164618
MGI: 103262
Ensembl: ENSMUSG00000053110
Vega: OTTMUSG00000038037
UniProt: P46938
Structure
PDB: 
6JK1 3JUA 6JK0

Position
9; 9 A1
AA seq 488 aa
MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNP
KTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLG
AVSPGTLTASGVVSGPAAAPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQ
TTTWQDPRKAMLSQLNVPAPASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKT
TSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEK
ERLRLKQQELFRQAIRNINPSTANAPKCQELALRSQLPTLEQDGGTPNAVSSPGMSQELR
TMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTGDTISQSTLP
SQQSRFPDYLEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLD
KESFLTWL
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggagcccgcgcaacagccgccgccccagccggccccgcaaggccccgcgccgccgtcc
gtgtctccggccgggacccccgcggccccgcccgcacccccggccggccaccaggtcgtg
cacgtccgcggggactcggagaccgacttggaggcgctcttcaatgccgtcatgaacccc
aagacggccaacgtgcctcagaccgtgcccatgcggcttcgcaagctgcccgactccttc
ttcaagccgcctgagcccaagtcccactcgcgacaggccagtactgatgcaggtactgcg
ggagctctgactccacagcatgttcgagctcactcctctccagcctccctgcagctgggt
gccgtttctcctgggacactcacagccagtggcgttgtctctggccctgccgctgcccct
gcagctcagcatctccggcagtcctcctttgagatccctgatgatgtaccactgccagca
ggctgggagatggccaagacatcttctggtcaaagatacttcttaaatcacaacgatcag
acaacaacatggcaggacccccggaaggccatgctttcgcaactgaacgttcctgcgcct
gccagcccagcggtgccccagacgctgatgaattctgcctcaggacctcttcctgatgga
tgggagcaagccatgactcaggatggagaagtttactacataaaccataagaacaagacc
acatcctggctggacccaaggctggaccctcgttttgccatgaaccagaggatcactcag
agtgctccagtgaagcagcccccacccttggctccccagagcccacagggaggcgtcctg
ggtggaggcagttccaaccagcagcagcaaatacagctgcagcagttacagatggagaag
gagagactgcggttgaaacaacaggaattatttcggcaggcaatacggaatatcaatccc
agcacagcaaatgctccaaaatgtcaggaattagctctgcgcagccagttgcctacactg
gagcaggatggagggactccgaatgcagtgtcttctcctgggatgtctcaggaattgaga
acaatgacaaccaatagttccgatccctttcttaacagtggcacctatcactctcgagat
gagagcacagacagcggcctcagcatgagcagctacagcatccctcggaccccagacgac
ttcctcaacagtgtggatgaaatggatacaggagacaccatcagccaaagcaccctgccg
tcacagcagagccgcttccccgactacctggaagccctccctgggacaaatgtggacctt
ggcacactggaaggagatgcaatgaacatagaaggggaggagctgatgcccagtctgcag
gaagcgctgagttccgaaatcttggacgtggagtctgtgttggctgccaccaagctagat
aaagaaagctttctcacgtggttatag

DBGET integrated database retrieval system