KEGG   Mus musculus (house mouse): 226041
Entry
226041            CDS       T01002                                 
Symbol
Pgm5, 4833423B07, 9530034F03Rik, D830025G17, aciculin
Name
(RefSeq) phosphoglucomutase 5
  KO
K15636  phosphoglucomutase-like protein 5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    226041 (Pgm5)
SSDB
Motif
Pfam: PGM_PMM_III PGM_PMM_I PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-GeneID: 226041
NCBI-ProteinID: NP_778178
MGI: 1925668
Ensembl: ENSMUSG00000041731
UniProt: Q8BZF8
Position
19:complement(24655625..24839206)
AA seq 567 aa
MEGSPIPVLTVPTAPYEDQRPTGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGC
TMVVGSDGRYFSRTATEIVVQMAAANGIGRLIIGQNGILSTPAVSCIIRKIKAAGGIILT
ASHCPGGPGGEFGVKFNVANGGPAPDVVSDKIYQISKTIEEYAICPDLRIDLSRLGRQEF
DLENKFKPFRVEIVDPVDIYLNLLRNIFDFNAIKSLLTGPSQLKIRVDAMHGVMGPYVRK
VLCDELGAPANSAINCVPLEDFGGQHPDPNLTYATTLLEAMKGGEYGFGAAFDADGDRYM
ILGQNGFFVSPSDSLAIIAANLSCIPYFRQMGVRGFGRSMPTSTALDRVAKSMKVPVYET
PAGWRFFSNLMDSGRCSLCGEESFGTGSDHLREKDGLWAVLVWLSIIAARKQSVEEIVRD
HWAKYGRHYYCRFDYEGLEPKATYYIMRDLEALVTDKSFIGQQFAVGSHIYSIAKTDSFE
YVDPVDGTVTKKQGLRIIFSDASRLIFRLSSSSGVRATIRLYAESYERDPSGHDQEPQAV
LSPLIAIALKISQIHERTGRRGPTVIT
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggaggggagccccatcccagtgctgacggtgcccacggcgccctatgaggaccagcgg
ccgaccggtggcggcgggctgcgacggcccacagggctcttcgagggccagcgcaactac
ctgcccaacttcatccagagtgtgctgtcgtccatcgacctgcgcgaccgtcagggttgc
accatggtggtgggcagcgacggcaggtacttcagcaggacggctactgagatcgtggtg
cagatggctgcggccaatgggattggtcgactgattattgggcagaatggcatcttgtcg
acccctgcagtctcctgcattatcaggaagatcaaggcagctggtgggatcattctaaca
gccagccactgtcctggaggaccagggggagagtttggagtgaagtttaatgttgccaat
ggaggtcctgcaccagatgttgtctcagacaaaatctaccagatcagcaaaacaattgag
gaatatgccatatgtccagatcttcgaattgacctatctcgactgggaagacaagaattt
gacctggagaacaagttcaaaccattcagagtggagattgtggaccccgttgacatctat
ctcaacctcctccggaatatctttgactttaacgccatcaagagtttgctgacaggaccc
agccaactgaagatccgtgttgatgctatgcatggagttatgggaccctatgtaagaaaa
gttctgtgtgatgaactgggagctccagccaactccgcaataaactgtgtcccactagaa
gacttcggagggcagcacccagacccaaacctgacctatgcaaccaccctcctggaagcc
atgaaggggggagaatatggatttggagctgcgtttgatgctgatggggaccgttatatg
atccttggccaaaatggcttctttgtgagtccctcagactctctcgccatcatcgctgcc
aacctctcttgcattccgtatttccgtcagatgggggttcgcgggtttgggaggagtatg
ccaaccagcacggctctggacagagtggctaaatcaatgaaggtccccgtgtatgagacc
cctgctggatggagattcttctcaaatctgatggactccggacgatgctctctgtgtgga
gaggagagcttcggcactgggtctgatcacctccgagagaaagatggcctctgggctgtc
ttggtctggctgtccattattgctgcccggaagcagagcgtggaggaaattgttagagac
cattgggccaaatatggccgccactactactgcaggtttgattacgagggactggagccc
aaggcaacctattacatcatgagggatctggaggccctagtgacagacaagtccttcatc
ggccagcagtttgctgtagggagccacatttacagcattgcaaagactgacagctttgaa
tatgtggaccccgtggatggcaccgtgaccaagaaacagggcctgaggatcatcttctcg
gatgcatcacggctaatattccggctcagttcctccagtggtgtgcgggccaccatcaga
ctgtatgcagagagctacgagagggatcccagtggtcacgaccaggaaccacaggcagtg
ctgagcccgctcatcgccatcgcattgaaaatatctcagattcacgagaggaccggccgg
agaggacccaccgtcatcacctga

DBGET integrated database retrieval system