KEGG   Mus musculus (house mouse): 226075
Entry
226075            CDS       T01002                                 
Symbol
Glis3, 4833409N03Rik, E330013K21Rik
Name
(RefSeq) GLIS family zinc finger 3
  KO
K09232  zinc finger protein GLIS1/3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    226075 (Glis3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    226075 (Glis3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 zf-C2H2_8 EpoR_lig-bind
Other DBs
NCBI-GeneID: 226075
NCBI-ProteinID: NP_001292600
MGI: 2444289
Ensembl: ENSMUSG00000052942
UniProt: Q0GE24
Position
19:complement(28236251..28657684)
AA seq 659 aa
MENSHSPYPSPRHSATRAHSTRSKKRALSLSPLSDGIGIDFNTIIRTSPTSLVAYINGPR
ASPANLSPQSEVYGHFLGVRGSCIPQSCAVASGQKGILVASGGHTLPGYGEDGTLEYERM
QQLEHGGLQPGPVNNMVLQPGLPGQDGQTANMLKTERLEEFPASALDLPSALPLPLPPPQ
GPPPPYHAHPHLHHPELLPHTQSLSLAQTGLEEDGEMEDSGGKHCCRWIDCSALYDQQEE
LVRHIEKVHIDQRKGEDFTCFWTGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCKK
AFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTK
RYTDPSSLRKHVKAHSSREQQARKKLRSSTELHPDLLTDCLAVQPLQPATSPGDAADHTV
GHSPGPGPGPGPGAELYSAPIFASNHSTRSGTAAGAGPPPHPVSHPSPGHNVQGSPHNPS
SQLPPLTAVDAGAERFAPPTPSPHHISPGRVPAPPSLLQRAQAPHSQQPPGSLLKPYQPE
TNSSFQPNGIHVHGFYGQLQTFCPPHYPDSQRTVPPSGSCSMVPSFEDCLVPTSMGQAGF
DVFHRAFSTHSGITVYDLPSASSSLFGESLRSGPEDPTFLQLSAVDRCPSQLSSVYTEG
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggaaaatagccactctccttaccctagccctcggcactcagcaaccagggcccactcc
acccgctctaagaagagagcattgtccttgtcgccactgtcagatggcatcgggatcgac
ttcaacactatcatccgtacttcacccacatccttggtcgcctacatcaacggaccaaga
gcctccccagccaacctgtccccacagtcagaggtctatgggcatttcctgggtgttcgt
ggcagctgcatcccccagtcttgtgcagtggccagcgggcagaaaggcatattggttgcc
agtggagggcatacgctgccgggctatggagaggacggtacactggagtatgaacgcatg
cagcagcttgagcatggtggcctgcaacccggacctgtaaacaacatggtgttgcagcct
ggcctaccgggccaggatggccagacagccaacatgctcaaaacagagcgcctggaggag
ttccccgccagtgccttggacctgccctctgctctgcctctccctcttcctccgcctcag
ggtcccccacccccataccatgcccatccacaccttcatcacccagagctcctgcctcac
acccaatcgctgtccctggcccagactggcctggaagaggatggggagatggaagactca
ggggggaagcactgctgccgttggatagactgcagtgccctttatgaccagcaggaggaa
ctggtgaggcacatcgagaaggtccacatagaccaacgcaagggggaagacttcacgtgc
ttctggactggctgccctagaagatacaagcctttcaacgcacggtataaactgctgatc
cacatgagggtccactctggggagaagcccaacaagtgtacgttcgaaggctgcaagaag
gccttttccaggctcgagaacctcaagattcacttgcggagccacacgggtgagaagcca
tacttgtgccagcatccgggctgccaaaaggccttcagcaattccagtgaccgtgccaag
caccagaggacacatcttgacactaaaccttatgcttgtcaaattccaggatgtacaaag
cgctacacagacccaagctccctcagaaagcacgtgaaggcacattcttcccgagagcag
caagcaaggaaaaagctacggtctagcactgagctccatccagatctcctcacagactgc
ctcgctgtgcagcccctgcagccagccacgtcccctggagatgctgctgatcataccgtg
gggcactccccagggccggggcctgggccagggcctggggctgaactctattcagctccc
attttcgccagcaatcattcaactcgaagtggaacagctgctggggctgggccaccccca
catcctgtcagtcacccttctccaggacataatgtacaggggagcccccacaacccctcc
tcccagttacctccactcacagctgtggacgcaggcgctgagaggtttgcacctccgact
ccatctcctcaccacatcagcccgggaagagttccagctcctccgtcactgctccagaga
gcacaggctccccactcccagcagccaccaggctcactcctgaagccctaccagccagaa
accaactcttcttttcagccaaatggtatccatgtccacggattttatggccagctgcag
acattctgtcccccgcattatcctgattcccaaagaactgtgccacccagcggctcctgc
agtatggtgccttcctttgaggactgcctggtccccacgtccatgggtcaagccggtttt
gatgttttccacagagccttctcaacacactcaggcatcacagtgtacgatttgccttca
gcttcctcaagcctctttggggaatctcttcgcagtggccctgaagaccccacgttcttg
cagctcagtgctgtggaccgctgtcctagccagctctcctctgtgtataccgaaggctga

DBGET integrated database retrieval system