KEGG   Mus musculus (mouse): 226089
Entry
226089            CDS       T01002                                 

Symbol
Ric1, C030046E11Rik, C130057E09Rik, Kiaa1432
Name
(RefSeq) RAB6A GEF complex partner 1
  KO
K20476  RAB6A-GEF complex partner protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    226089 (Ric1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    226089 (Ric1)
SSDB
Motif
Pfam: RIC1
Other DBs
NCBI-GeneID: 226089
NCBI-ProteinID: NP_001074788
MGI: 1924893
Ensembl: ENSMUSG00000038658
Vega: OTTMUSG00000034266
UniProt: E9QPA1
Position
19; 19 C1
AA seq 1422 aa
MYFLSGWPKRLLCAPRSPAEAPLHVQSDPRRAFFAVLAPARLSIWYSRPSVLIVTYKEPA
KSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSSRGDKYLYEPVYPKGSPQMKGIP
HFKEEHCAPALNLEMKKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAIN
LSTVPFSVDLQSSRVGSFLGFADVHIKDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAE
QLHGVWPQDVIDGTCVAVNNKYRLMAFGCASGCVQVYTIDNTTGAMLLSHKLELTAKQYP
DIWNKTGAVKLIRWSPDNSAVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPL
KINSMSWGAEGYHLWVISGLGSQHTQIETDLRSTVKEPSILLFQFIKSVLTVNPCMSNQE
QVLLQGEDRLYLNCGEASQAQNPKYSSARAERMPRHEKSPFADGGLEAPGLSTLLGHRHW
HVVQISSTYLESNWPIRFSAIDKLGQNIAVAGKFGFAHYSLLTKKWKLFGNITQEQNMIV
TGGLAWWDDFMVLACYNLSDRQEELRIYLRTSNLDNAFAHVTKAPMETLLLSVFRDMVVV
FRADCSICLYSIERKSDGSNTTASVQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGISLK
MPQQARDAESIMLNLAGQLIMMQRDRSGPQIREKDSHPNQRKLLPFCPPVVLAQSVENVW
TTCRANKQKRHLLEALWLSCGGAGMKVWLPLFPRDHRKPHSFLSQRIMLPFHINIYPLAV
LFEDALVLGAVNDTLLYDSLYTRSSAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNLG
EQALLLAQSCAALPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQTV
VHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATL
LFNTALEQGKWDLCRHMIRFLKAIGSGESETPPSTPTSQEPSSSGGFEFFRNRSISLSQS
AENVPPGKFGLQKTLSMPTGPSGKRWSKDSECAENMYIDMMLWRHARRLLEEVRLKDLGC
FAAQLGFELISWLCKERTRAARVDNFVVALKRLHKDFLWPLPIIPASSISSPFKNGKCRA
VGEQMLKSQSADPFITPEMDAGISNIQRSQSWLSNIGPTHRDTDRASSPGPQMQDAFLSP
LSNKGDECSIGSATDLTESSSVVDGDWTMVDENFSTLSLTQSELEHISMELASKGPHKSQ
VQLRYLLHIFMEAGCLDWCVVIGLILRESSVVSQLLGIAQSSEMDGEMLQNIKSGLQAVD
RWASTDCPGYKPFLNIIKPQLQKLSEITEELVQPDTFQPVTVGKTPEQTSPRAEENRGSC
SHGSISQSEPGSNNVVSRKEEDTTQADEEEPLQDGAYDCSVS
NT seq 4269 nt   +upstreamnt  +downstreamnt
atgtatttcctgagcggctggcccaagaggctgctctgcgcgccgcggagcccggccgag
gcgccgctccacgtccagtctgaccctcggagagcgttcttcgccgtgctggccccggcc
cgcctcagcatctggtacagccgacctagtgtgttaattgtaacatacaaggaaccagct
aaatcatctactcagtttggatcttacaaacaagctgaatggagaccggatagtaccatg
atagcagtgtcaacagcaaatggctacatcttgttttttcatattacatcttcaagaggg
gataaatacctttatgaaccagtgtatcccaaaggaagtccacaaatgaaggggatacct
cattttaaggaagaacattgtgccccagcattgaatttagaaatgaagaaaatactggat
ttgcaagcacccattatgagtttgcagtctgtgctggaagatctccttgttgcaacttct
gatggacttcttcatcttattcattgggaaggaatgacaaatggaagaaaagccatcaat
ctgtctacagtaccattttcagtagacctccagtcatccagagttggttcattcctcggc
tttgcagatgtgcacattaaagatatggaatactgtgccacacttgatggatttgctgtt
gtgtttaatgatggtaaagttggatttattacaccagtatccagtagatttacggcagag
caacttcatggagtttggccacaagatgttattgatgggacttgtgttgcagtaaacaac
aaataccgactgatggcctttggctgtgcaagtggctgtgtgcaggtttatacaatcgac
aacactacaggagccatgctgctgtcccataaactagagctcacagcaaagcagtatcct
gacatctggaacaaaacaggagctgttaaattgattagatggtctcctgacaacagcgct
gtaatagtaacctgggaatatggaggtctttctctgtggagtgtgtttggagcccagctg
atatgtacacttggaggagacttcgcttacaggtcagatggtaccaaaaaagatcccctt
aagatcaactccatgagctggggtgcagaaggctatcacttatgggtaatcagtgggctg
ggctctcagcacactcagattgagaccgacctcaggagcacagttaaagagcccagcatt
ctgctgtttcagtttatcaagagtgtactcactgtgaacccttgtatgagtaaccaagag
caggtgttgcttcagggagaagatcgcttgtacttgaactgtggagaagcctcacaggcc
cagaatccgaagtactcttcagcacgtgctgagcgtatgcccaggcatgagaagagccca
tttgcagatggaggtctggaggctccgggattaagcactttacttggtcatcggcattgg
catgttgtgcagatttccagcacctatctagaaagcaattggcctatacggttttcagct
attgataaacttggacaaaatattgctgtggctggcaagtttggatttgctcattattct
ctactcaccaaaaaatggaaactttttggaaacattactcaggagcaaaatatgattgtg
actggtggcttagcctggtgggatgactttatggtccttgcgtgttacaacttaagtgac
cgtcaagaagagctcagaatctacctacgaacatccaacctggacaatgcctttgctcat
gtcaccaaagcaccaatggaaacattactgcttagtgtcttccgcgacatggtggtagtg
tttcgagcagactgttcaatatgcctttacagtattgaaagaaaatccgatggttccaat
actacagctagtgtccaggttcttcaggaggtctccatgtcacggtacattcctcacccc
ttcctggtagtgtctgtcacgctgacgtcagtgagtacagagaatggcatcagcttgaaa
atgccgcagcaggctcgtgatgcagagagcataatgctgaaccttgcgggacagctcatc
atgatgcagagggacaggtcaggcccgcagatccgggagaaggacagccaccctaaccaa
aggaagcttctgccgttctgtcctcctgttgtactagcccagtcggtggaaaatgtctgg
actacctgtcgagcaaacaaacaaaagcgtcaccttctggaggccctctggctgagctgt
ggtggtgcggggatgaaggtttggctccctctcttccccagggatcatcgcaagccccac
tccttcctgtcccagcggatcatgctgccgtttcatatcaacatttaccccctggccgtt
ctgtttgaagacgcgttggtccttggtgctgtcaacgacactctcctctatgattctctg
tatacccggagcagtgccagggagcagctggaggtgctctttcccttctgtgttgtggag
aggacctctcagatctacctccaccatatcctccgccagctcctggtcaggaacctgggc
gagcaggcgctcctcctggctcagtcctgcgctgcgttaccttacttccctcacgtgttg
gagctgatgctccacgaggtgctggaggaagaagctacctcccgggagcccattcccgac
ccgctgctgcccaccgtggccaagttcatcaccgagttccccctcttccttcagacagtc
gtgcactgtgccaggaagactgagtatgctctgtggaattacctttttgcagctgtcgga
aaccccaaggatttatttgaggaatgtttgatggctcaggatttggacacagctgcctct
taccttattatcttacagaatatggaagtcccagcagtaagtaggcagcatgctaccctg
ctgttcaacacagcactggaacagggcaaatgggacctgtgccgacacatgattcgattt
cttaaagccattggttctggagaatctgagacccctccatccacacctacatctcaggag
cccagttcaagtggtgggtttgagttcttcaggaatcggagcatcagtttatcccagtca
gctgagaatgttcctcctggtaaattcggcttacagaaaacactaagtatgccaactggt
ccttctgggaaaagatggagcaaagacagtgaatgtgctgagaacatgtatattgacatg
atgctgtggagacatgcgcggcgcctcctagaagaggtgcgcttaaaggaccttggctgc
tttgcagcccagctaggctttgaactgatcagttggctttgcaaagaacgtacccgagct
gcccgtgtagacaactttgtagtagccctgaagagacttcacaaggatttcctgtggcca
cttcccattatcccagcctcttccataagttcccctttcaaaaatgggaaatgccgagca
gtgggagagcagatgttaaagtctcagtcagctgacccttttattacccctgagatggac
gctggcatctctaacatccaacgaagtcagagctggctcagcaacattggtcccacccat
cgtgacacagacagagcctcatctcctggaccacaaatgcaagatgctttcttgtctcca
ttatctaataaaggggatgagtgcagcattggctcagctacagacctgactgaaagcagc
tccgtggtggatggagactggacaatggtggatgaaaacttctccaccctcagcttgacc
cagtctgagctagagcacatctccatggagttggcgagtaaaggaccccataaatctcag
gtccagcttcgctatttgctgcacattttcatggaggcgggatgtctggactggtgtgtt
gtcatcggcctgattctcagagaatcctcagtggtcagtcagcttcttgggattgctcag
tcttccgagatggatggagagatgttacagaacataaaatcagggctgcaagcagtggac
cgctgggcctctacagactgccctggatataagccatttttaaacatcattaagccacaa
ctgcagaagctcagtgagataacagaagaactggtccagcctgacaccttccagccagta
acagtgggtaagactcctgaacagaccagtccccgggcagaggagaacagaggctcttgc
agccatgggagcatctctcagagtgagcctgggagtaacaacgtggtcagccggaaagaa
gaggacacaacacaggcggatgaggaggagccacttcaggatggggcttatgactgttct
gtgtcctga

DBGET integrated database retrieval system