KEGG   Mus musculus (mouse): 226139
Entry
226139            CDS       T01002                                 

Gene name
Cox15, 2900026G05Rik
Definition
(RefSeq) cytochrome c oxidase assembly protein 15
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu00860  Porphyrin and chlorophyll metabolism
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    226139 (Cox15)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    226139 (Cox15)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    226139 (Cox15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    226139 (Cox15)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    226139 (Cox15)
SSDB
Motif
Pfam: COX15-CtaA Peptidase_S3
Other DBs
NCBI-GeneID: 226139
NCBI-ProteinID: NP_659123
MGI: 1920112
Ensembl: ENSMUSG00000040018
Vega: OTTMUSG00000026393
UniProt: Q8BJ03
Position
19; 19 C3
AA seq 413 aa
MQRLLLPSLRALTGSRNVGLLVPRVASRTQCGSSCGSQRPLRPGQYSTITEVALQSGKGT
VSLPSRAAERAVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEW
EAEFQKYQQFPEFKILNHDMTLAEFKFIWYMEYSHRMWGRAVGLAYILPAAYFWRKGWLN
RGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSALVLYCAS
LWTSLSLLLPQHKLPETRQLLWLRRFAGGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMG
ESWIPEDLLTFSPVLKNVFENPTMVQFDHRLLGVTSVTAITVLYFLSRRIPLPRRTKMAA
VTLLALAYAQVALGISTLLMYVPTPLAATHQSGSLALLSGALWLMNELRRVPK
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcaacggttgctccttccgtccctgagggccttgacggggagccgcaatgtcgggctc
ctggtccctagggtggcgtccagaacacagtgtggcagcagctgtggcagccagcgtcct
ctgaggccaggacagtacagcaccatcactgaagtggctctgcaatccggaaaagggaca
gtgtcccttccttcgagggcagccgagcgggcggtgggccgatggcttctggtgtgcagt
gggacagtggctggagcagttattctgggaggagtgaccaggttgacagagtctggcctc
tcaatggtagactggcatctgataaaggagatgaagccgcccacaagccaggaagagtgg
gaagcagagttccaaaagtaccagcaatttccagaatttaaaatcctgaaccatgacatg
acgctggcggaattcaagtttatctggtacatggaatactcacaccggatgtgggggcga
gctgtaggccttgcatacatcctgcctgctgcctacttttggagaaagggttggctcaac
cgtggcatgaaaggacgtgttctcgccctctgtggcttagtctgtttccagggtctgttg
ggttggtatatggtgaaaagtggattggaagaaaaaccagagtcctatgacatccctcgg
gtcagtcagtaccgcctcgcagcccacctggggtcagcactggttctctactgtgccagt
ctgtggacctccctgtcactgctactgcctcagcacaagttaccagaaactcggcagctc
ctgtggttgagacggtttgctggtggcacagcaggcctggtgttcctcacggctctctca
ggggcttttgtggcagggctggatgctggcctcgtttacaactccttccccaaaatggga
gaatcttggatcccagaggacctcctgaccttctcccctgtcctgaagaatgtttttgag
aatcctaccatggttcagtttgatcacaggcttctgggagtcacgtctgtcactgccatt
acagtgctctatttcctgtcccggagaatcccccttcctcgaagaaccaagatggcagca
gtgactctgctagctttggcatatgcacaggtggccctgggcattagcactctgcttatg
tacgtccccactccgctggctgccacacaccagtcaggctccttggctctgctcagtggt
gccctttggctcatgaatgaactccgaagagtccctaaataa

DBGET integrated database retrieval system