KEGG   Mus musculus (mouse): 226151Help
Entry
226151            CDS       T01002                                 

Gene name
Slf2, 3632432H19, Fam178a
Definition
(RefSeq) SMC5-SMC6 complex localization factor 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM178
Motif
Other DBs
NCBI-GeneID: 226151
NCBI-ProteinID: NP_001074694
MGI: 1924968
Ensembl: ENSMUSG00000036097
UniProt: E9Q839
Position
19; 19 C3
AA seq 1163 aa AA seqDB search
MTRRCMPARPGFPSSPAPGSSPPRCHLRPGSTAPAAAGKRTESPGDRKQSIIDFFKPAAK
QDKHMLDSPQKSNIKYRGNGLSITGTEQFERKLSSPKKLKPKRMSSEESPILEAFMKGGK
EHHKDRGVHESRRPCMSLSKYLPKGAGIYAPSSYRLPKEIKAQKKKHQSPERRKSLFIHE
SNREKNDRDRGKNSEDSRKQATATEGDIFKHSSRSISSRSSLSRHHPGESTLGARFQLSL
ASYCREREQKKLRKEQMEQRINSENSFSEASNLSLKSSGVGKNCKPRHEHSKHTEAVPGK
SNLSTLENGHLSRKRSSSDSWELSGSKQNKFSDKRKRNSVDSDLKSTKEPIIPKARESFL
EKRPDTSHQREKFIRHIALKTPGGVLRLEDIAKEPEDETDRSSADSAPSNAGHHSSRNSD
QVHSASTKETKIQKPHLPLPQEKSTIKRASNLQKNKPAGSVTSKETKLPLLSHVPSAVSS
RVPLNAKNCTLPVPKKDKERSSSKERSGHSTESSKHKEHRAKTIKAVSNESSGKNSGGSL
HSEYAPPTASPPAALEVVPSVPSPAAPSDKESSGNSNAGSNALKRKFRGDFDSDEESLGY
TLESDEEEETLKSLEEIMALNFSRTPTTSGKPPAVSKGLRSQSSDYMEYAQSGTYTNTLE
RLVKEMEDTQRLDELQKKLQEDIRQGRGIKSPLRTGDQDSTDDGDGLLEEHREFLKKFSV
TVDAIPDHHPGEEIFNFLNSGKIFNQYTLDLRDSGFIGESAVEKLILKSGKTDQIFLTTQ
GFLTTAYHYVQCPVPVLKWLFRMMSVHTDCIVSVQILSTLMEITIRNDTFSDSPVWPWIP
SLSDIAAVFFNMGVGFGSLFPLETLQPDFNEENLISETQKTLGGKESEDSPYSPVFSALP
ETNILNVVKFLGLCTSIHPEGYQDGELMLLILMLFKMSLEKELKQIPLVDFQSLLINLMK
NIRDWNTKVHELCLGINELSSHPHNLLWLVQLVPNWTSRGRQLRQCLSLVMMSKLLDEKH
EDIPNANNLQISVLHRYLVQMKPSDLLKKMVLKKRAEQPNETIDDSLHLELEKQAYYLTY
ILLHLVGEVSCSHSLSSGQRKHFVLLCGALEKHVKCDIREDARLFYRTKVKDLVARIHGK
WQEIIQNCRPTQGQLHDFWVPDS
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcgctgcatgcccgctaggccaggtttcccctcatccccagccccggggtcg
tcgcccccgcgctgccatctgagacccggtagtaccgcccctgctgcagcgggaaaaaga
acagagagtcctggggacaggaaacagtcaatcatagatttcttcaagccagctgcaaaa
caagacaaacatatgttggattcgcctcaaaaatcaaacatcaaatacagaggaaatgga
ttatccatcactgggacagagcaatttgaaaggaaattatcttcaccaaaaaaacttaaa
cctaagaggatgtcatcagaagaaagtcctattttagaggctttcatgaaaggtgggaag
gagcaccacaaagatcgtggtgtccatgagtcacggcggccttgtatgtctctaagcaaa
tatttacccaaaggagctggcatctatgctccttcctcttatcgattgcccaaagagatc
aaggcacagaagaaaaaacaccagtctcctgagagaaggaagtcactgttcattcatgaa
agtaacagggagaagaatgacagagatcgaggcaagaacagtgaagactccagaaaacag
gccacagccacagaaggtgacatcttcaagcatagctccagaagtattagtagcagaagc
agcctgtccaggcaccatccaggagaaagcacactgggggctaggttccagctgtcatta
gcttcttactgccgagagcgagaacagaagaagttgagaaaggaacaaatggagcagaga
atcaactcggaaaattctttctcagaagcaagcaacctttccttaaagtcgtctggtgta
gggaaaaactgtaagccgaggcatgagcatagcaagcacactgaggctgtacctgggaag
agtaatctctcaactctggaaaatggacatctctcaagaaaaagatcatcttcagactcg
tgggaactttcaggctctaaacagaataaattctccgacaaaagaaagaggaactctgtg
gactcagacctgaaaagcacaaaagaacctatcataccaaaagcaagagagtcctttcta
gagaagcgcccagacacatcccatcagagagaaaagtttatcagacacattgcactgaag
actcctggtggtgttctgcgcttggaagacatagccaaggagcctgaggacgagacagat
cgctcttctgcagactcggcaccttcaaatgctggccaccattcttccaggaatagtgac
caagtccactcagcaagtaccaaagagactaaaatacagaaaccccacttacctttacct
caggaaaaatctacaattaaaagagctagcaaccttcagaaaaacaaaccggctggctct
gtgacatcaaaagagacaaagctacctttactttcccatgttccaagtgctgtttcctct
cgagtaccactaaatgctaaaaattgcactcttccagttcctaaaaaagataaagagcgt
tcctcctcaaaagaacgttctgggcattctacagaatcctccaaacacaaggaacacaga
gcaaagactattaaggctgtttctaatgaatcgtcagggaaaaattctgggggatctttg
cattcagagtatgcccctccaacagcatctcccccagctgccttggaagtcgtgccgagt
gtcccaagccctgcagcaccttcagataaagagagttcaggaaattccaatgcaggtagc
aatgcactgaaaaggaaattcaggggtgattttgatagtgatgaagaaagtttaggttac
accttagagagtgatgaggaagaggaaacactaaaatcactggaagaaataatggctctg
aacttcagtcggactcctacaacttcaggaaagcctcctgcggtttccaaggggcttaga
tcccagtcgtcagactacatggaatatgctcagagcggaacttacacaaataccttagag
cgactagtaaaggagatggaagacacgcagaggctagatgaactacagaagaagctacag
gaagacataagacaaggccgtggcattaaatctcctctcagaactggcgatcaggatagt
acagatgatggtgatggcctcttggaagaacacagggaatttctaaagaaattttcagtt
acagttgatgctattcctgatcatcatccaggtgaagaaatatttaatttcctcaattct
ggaaaaattttcaatcagtataccttagatttaagagactctggttttattggagaaagt
gctgtggaaaagcttattctcaaatcaggaaaaacagatcagatttttttgacaacacaa
ggcttccttaccactgcatatcactacgtccaatgtcctgtacctgtgttaaagtggctg
tttcggatgatgtcggttcacacagattgtattgtgtcggtgcagattttaagtacattg
atggaaataaccattagaaatgatactttcagtgactctccagtttggccctggatccca
tctttgtctgatatagcagctgtattcttcaacatgggcgttggttttggatctttgttt
cctctggagactcttcagcctgactttaatgaagaaaatctaatttctgaaacacagaaa
acactggggggaaaagaaagtgaagattcaccttatagtccagtattttcagctcttcct
gaaaccaacattttaaatgtggttaagttcctaggtctgtgcacatctatacatccagaa
ggttaccaagatggagaattaatgctgctgattttaatgctgtttaaaatgagtttggaa
aaagagcttaaacagattccattagtagactttcagagcctcctgataaatctcatgaaa
aacatcagagattggaacacaaaggttcatgaactctgtctgggcataaatgaactctcc
agtcatccccataaccttctttggttggtacagctagtccctaactggacatctcgtgga
aggcagctgaggcagtgcctcagtctggtgatgatgtcaaagcttttggatgaaaagcat
gaagatattcctaatgccaataaccttcagatctcggtcctgcatcgatatcttgtgcag
atgaagccttctgatttgttgaagaaaatggtcttgaagaaaagggccgaacagccaaat
gaaactattgatgacagtcttcatttagaacttgaaaagcaggcatattacctgacctac
atccttcttcatttagttggggaagttagttgctctcattctctttcttctggacaacgg
aaacacttcgtgctgctttgtggggctttggaaaagcatgttaagtgtgatattagggaa
gatgcaagacttttctacagaactaaagtgaaagacttggttgccagaatacatggaaaa
tggcaggaaataattcagaactgtcggcctactcaggggcagcttcatgacttctgggtg
ccagattcttaa

DBGET integrated database retrieval system