KEGG   Mus musculus (mouse): 226154
Entry
226154            CDS       T01002                                 

Gene name
Lzts2, BC014695, LAPSER1, mKIAA1813
Definition
(RefSeq) leucine zipper, putative tumor suppressor 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Fez1 DUF4250 DUF1127
Other DBs
NCBI-GeneID: 226154
NCBI-ProteinID: NP_001123997
MGI: 2385095
Ensembl: ENSMUSG00000035342
UniProt: Q91YU6
Position
19; 19 C3
AA seq 671 aa
MAIVHTLPVPLEPARETATAPKTPAMGSVSSLISGRPCPGGPAPQRHHGVPGPTFFRQQD
GLLPGGYEAQEPLCPAVPPRKAVPGNSFTYVNEDFRTESPPSPSSDVEDPREHQAHNAHL
RGPPPKLIPVSGKLEKNMEKILIRPTAFKPVLPKPRGAPSLPGFLGPRAAGLSGSQGSLT
QLFGGPASSSSSSSSSSAADKPLALSGWASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTT
NSPGGHLPSHGPGRGALPGPARGVPTGPSHSDSGRSSSSKSTGSLGGRVAGGLLGSGARA
SPGSSSGGDRSPPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSMDESEATVCQAFG
ARQRRWPRERGEDCAAQAQQATQRVQRAQQLLQLQVFQLQQEKRQLQDDFAQLLQEREQL
ERRCATFEREQRELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKGSELVALRVAL
REARATLRVSEGRARGLQEAARAREQELEACSQELQRYRQEAERLREKAGHLDAEASGLR
DPPVPPATTDPFLLAESDEAKVQRAAAGAGGSLRAQVERLRQELQREQRRGDEQRDSFEG
ERLAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAESAPC
ICLEEITATEI
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggccattgtgcacactctgccagtgcctctggagcccgcacgtgagacagccactgcc
cccaaaactccagcaatgggcagcgtgagcagtcttatctcaggccggccctgccccggg
ggacctgctcctcaacgacatcatggtgtccctgggcccaccttcttccgccagcaggat
gggctgctaccgggtggctacgaggcacaggaaccgctctgcccggctgtgccaccgagg
aaggctgtcccaggcaatagctttacctatgtcaatgaggacttccggacagagtctcct
cccagccccagcagtgatgttgaagatccccgggaacatcaggcacacaatgcccacctc
cgtgggcccccaccaaagctcatccctgtctctggaaagctggagaagaatatggagaag
atcctgatccggccaacagccttcaagccagtgctacccaaacctcggggggcgccatcc
ctacccggcttccttggtcctcgagctgctgggctatctgggagccagggcagcctgaca
cagctgtttggggggccagcctcttcctcctcctcttcctcttcctcctctgctgctgac
aaacccttggcactgagtggttgggccagtggctgcccttcaggaacgctgtcagactct
ggccgaaattctttatccagcttgcccacctacagcactggaggtgccgagccaaccacc
aactccccaggtgggcacctgccctcccacggccctggccgaggggcactgcctggtcca
gcccgaggggtccctactgggccctcccattcagacagtggccggtcctcctccagcaaa
agcacgggctccttggggggtcgtgtagctggggggctcttgggcagtggtgcccgggcc
tcccctggcagcagttctggtggagaccgctctccaccccctccaccacctccaccccct
tcggatgaggccttgctacactgtgtcctggaagggaagctcagagaccgcgaggcagag
ctgcagcagctgcgggacagtatggatgagagtgaggccacagtgtgtcaggcattcggg
gcacggcagcggcgctggccacgggagcgaggggaggactgtgcagcccaggcgcagcag
gccacgcagcgcgtccagcgggcccaacagctgctgcagctgcaggtgttccagctgcag
caagagaagcgccagttgcaggatgactttgcccagctgctacaggagcgggaacagctg
gagcgccgctgtgccacttttgaacgggagcagcgggaactcgggccacggctggaggag
accaaatgggaggtgtgtcagaaatcaggtgagatctccctgctgaagcagcaactgaag
gaatctcaggcagagctggtccagaagggcagtgagctggtggcgctgcgggtggccctc
cgtgaggcccgggccaccttgcgggtcagtgagggccgtgccaggggcctgcaggaggca
gcccgagctcgggagcaggagctggaggcctgctcgcaggagcttcagcggtaccgccag
gaggctgagcggctccgggagaaggccgggcatttggatgccgaagcatcgggactccgg
gatccccctgtaccccctgccaccaccgacccgttcctcctggcagagagtgatgaggcc
aaggtgcagcgggcagcggctggggcagggggtagcctgcgggctcaggtggaacggctg
cgccaagaactgcagcgggagcagcggcgaggggacgagcaacgggacagctttgagggg
gagcggctggcctggcaggcagagaaggaacaggtgatccgctaccagaagcagctgcag
cacaactatatccagatgtaccggcgtaaccggcagctggagcaggaactgcagcaactg
agcctggagctggaggcccgcgagcttgcggatttgggcctggcggagtcggccccttgc
atctgtctggaggagatcactgccactgagatctag

DBGET integrated database retrieval system