KEGG   Mus musculus (mouse): 226169Help
Entry
226169            CDS       T01002                                 

Gene name
Pprc1, A930018M19, BC013720, PRC, mKIAA0595
Definition
(RefSeq) peroxisome proliferative activated receptor, gamma, coactivator-related 1
  KO
K17963  peroxisome proliferator-activated receptor gamma coactivator-related protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    226169 (Pprc1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    226169 (Pprc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1
Motif
Other DBs
NCBI-GeneID: 226169
NCBI-ProteinID: NP_001074683
MGI: 2385096
Ensembl: ENSMUSG00000055491
Vega: OTTMUSG00000023305
UniProt: Q6NZN1
Position
19; 19 C3
AA seq 1644 aa AA seqDB search
MAARRGRRDRVAPPPTGGPGPDPGGGVRGGSWASRSQAPYGTGGSVSAAEQVHEEGNDSS
FVSLSRLGPSLREKDLEMEELILQDETLLETMQSYMDASLISLIEDFGESRLSLEDQNEM
SLLTALTEILDNADSENLSPFDTIPDSELLVSPRESSSLHKLLNLSRTPPERDLITPIDP
LGPSTGSSRVSGVEVPLADSPWDFSPPPFLETSSPKLPSWRPSRPRPRWGQSPPPQQRSD
GEEEEEVAGFSGQMLAGKLDNSVNNVLDFPMHLACPEEEGTAEGADAPASAPGDESISSL
SELVRAMHPYCLPNLTHLASLEGELEGQADADADELTLPEGCVVLEIVGQAATTGDDLEI
PVVVRQIPSGSQSVLLDESLGSSPALQLLMPTMESETEAAVPEVAPCPDEELPLSSACLL
EPREIMESLTPKEPQSLPASASQGSQKVPRKGRKKKNKEQPTACVEACTRRLRSSSRGQS
TVSAEVNSQAGSSQKQPQEELQREAAALQSRGKPRAWARAWAAALEKTGSENLERSAGQD
SPAEEDALDLCPKLLETSQANPTLSLNDSAQADSMPVDSVEGDSPAVGNAAPGDQASSGT
ELVGSLPVGPNLTSPVLADKKGIEPAVAIPTSDNLSPADVLANTVAADPVPNDPAPADPV
LVKCRPTDPRRAAAAAAAAAQGSRPSLQSADHPKVVSPEGKDVVGPLKVEGSTSATTQEA
KPRPLSLSEYRQRRQQRQTEAEDRNSQPPVVGKWPSLPETPTELADIPCLVPSAPARKTA
PQRSPIAVPETVSVGSNPVSPTPEPSASKLMVSTHSEQVSSHEMPLAVRPPPPPLPSVSP
AGPIPSTVPAPLPPFPPSVPPLLPLPSGGHGVPRLPPPPLQPPGLPVSMRQMPPDPYTQY
APVPPWSCYPSVSPPGYSCLPPPPTMPIVSGTPGTYAVPPTCNVPWVPPPAPVSPYSSSC
AYGSLGWGPGLQQPPFWSTVSPPPLSSVPTGRAVPPTPVEPSGDPAGPPEDVLPGPVTPS
LSSGPASPAAPPVEPTKPEAQPVPVSPQPKHKVSTLVQSPQIKAPPTLSTEGVVFEESVS
ERLKSETQENRPKEKPISTAIKSVPVPKQSAVAKLPAVHPARLRKLSFLPTPRAQGPEDV
VQAFISEIGIEASDLSSLLEQFEKSEAKKECPLPASADSLAVGNSGIDIPQEKKPLDRLQ
APELANVAGLTPPATPPHQLWKPLAAVSLLAKAKSPKSTAQEGTLKPEGITEAKPPATAC
LQEGAHSPSPVHVGSGDHDYCVRSRTPPKRMPALVISEVGSRWNVKRHQDITIKPVLSLG
SAAPPLPCTATSQEPLDHRTSVEQADPSAPCFAPSTLLSPEASPCRSEMNARTPPEPSDK
QQSMRCYRKACRSVSPSSRGWQGRRGRSSRSVSSGSSRTSEASSSSSVSSSSRSRSRSRS
RSFSPPNKRWRRSSCSSSGRSRRCSSSSSSSSSSSSCSSRSRSPSVSPCRRSDRRRRYSS
YRANDHYQRQRVLQKERAIEERRVVFIGKIPGRMTRSELKQRFSVFGEIEECTIHFRVQG
DNYGFVTYRYAEEAFAAIESGHKLRQADEQPFDLCFGGRRQFCKRSYSDLDSNREDFDPA
PVKSKFDSLDFDTLLKQAQKNLRR
NT seq 4935 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgccggggacggagagaccgagtcgcgccgcctccgactgggggcccgggt
cctgaccctggcggtggagtgcgtggcggcagttgggcgagtcgaagccaagcgccgtat
gggaccgggggctccgtgagcgccgcggagcaggtccatgaggaagggaatgactctagc
tttgtcagtctttctcgactgggcccctctctgagggagaaagacctggaaatggaggaa
ctgatactgcaggatgagaccctcctggagaccatgcagagctacatggacgcctccctt
atatccctcattgaggattttggagagagcagattatctctggaggaccagaatgaaatg
tcgctgctcacagctctgacggagatcttggacaatgcagattctgagaacctgtcccct
tttgacaccattcctgattcagagctgctcgtgtcccctcgggagagctcctctctgcac
aagctgctcaatctctctcggacacccccagaacgtgaccttatcaccccaattgaccct
ttggggcccagcacaggaagtagtcgggtgagtggggttgaggtgcctcttgcagactct
ccatgggacttctctccgcctcctttcttggaaacttcttcccctaagctgcctagctgg
agaccctcgagaccaagacctcgatggggtcagtcccctcctcctcagcagcgcagtgat
ggggaagaggaggaggaggtcgccggtttcagtggtcagatgcttgctggcaaactcgac
aactctgtgaacaatgtcctggacttccccatgcacctggcatgccctgaggaagaaggc
acagccgagggagcagatgcgccagcgtcagcccctggtgacgagagcatctcctccttg
agtgagctggttcgggccatgcatccctactgcttgcccaacctcacccacttggcatcc
cttgagggtgaacttgagggacaggctgatgctgacgctgacgagttgacgctgcctgag
ggctgtgttgtactggagattgttggccaggcagccacaactggtgatgacctcgagatc
ccagtcgtggtgcggcagattccttctggatcccagtctgtgctcctggatgagtctcta
ggaagcagtcctgccttgcagttactcatgcccaccatggagtccgagaccgaagctgct
gtgcctgaagttgctccttgccccgatgaagaattaccactgagctccgcctgcttattg
gagcccagggaaatcatggagtcattgacacccaaggaacctcagagcctacctgccagt
gcaagtcagggttctcagaaagttcccagaaagggtaggaagaagaagaacaaggaacag
ccaacagcctgtgtggaagcctgtaccaggcggctgaggtcatcttctcgaggacagtct
actgtgtctgcagaggtgaactctcaggcaggcagttcacagaaacagccccaggaagag
cttcagagagaggctgctgcccttcagagcagagggaagccacgggcttgggctcgggcc
tgggcagctgccttagagaagacagggtccgagaatttagagagaagtgcgggacaggat
agtcctgctgaagaagacgcactggatctctgtcctaagctgcttgagaccagccaagcc
aaccccactctctcattaaatgactctgctcaagctgactccatgcctgttgactctgtt
gaaggtgattcccctgcagttggcaatgctgcacctggtgatcaggcttcatctggtaca
gagctggttggttctctcccagtaggcccaaacctgactagcccagtcctggctgacaag
aaaggaattgaacctgcagtggctattcccacttcggataacttgtctccagctgatgtc
ctagcaaacacagtggcagctgaccctgttccaaatgaccctgctccagcagatcctgtg
ctagttaagtgcagacccactgatcctaggcgtgctgcagcagcagcagcagcagcagct
caggggagtcgtccttccctacagtccgcagaccatcctaaggtcgtcagccctgaaggc
aaggatgttgtaggtcctctgaaggtggaaggtagtaccagcgctacaacccaggaagcc
aaacctcggcctctcagcctatctgagtaccgtcagcgaaggcagcaacggcaaacggaa
gcagaagacaggaattctcagcccccagttgttggcaagtggcctagtctcccagagacc
cccacagaactggcagatatcccttgccttgttccatcagccccagccaggaagacagct
ccacagagaagccctatagctgtaccagagactgtgtctgtgggttctaatcctgtttcc
cctactcctgagccatctgcaagcaaacttatggtttcaactcactctgaacaggtgtca
tctcatgagatgccacttgcagttagaccaccccctcctcctttgccgtctgtgtctcct
gctggacccatcccgtccacggtgcccgctcctttgcctcctttccctccgagtgtaccg
cctttgcttcctcttccttcaggtggccatggagtcccccgcctgcccccacctcctttg
caacctcctggacttccagtatcaatgagacaaatgccacctgacccctatactcagtat
gcccctgtgccaccctggtcttgttacccctctgtgtcccctccgggctattcttgtttg
cccccaccaccaacgatgcccatagtatctggtactcctggtacctatgctgtgccccca
acttgcaatgtgccttgggtaccccctcctgcaccagtttcaccttacagctccagctgt
gcctatggatcccttgggtggggcccagggctgcaacagcctcccttttggtctactgtt
tctccacctccgttgtcttcagtccctactggaagagctgttcccccgacccccgtggaa
cccagtggtgatcccgctggtcctcctgaagatgtgcttcctgggccagtgactccttcc
ctaagctccgggccggccagccccgcagctccaccagtagaacctacaaagccggaggct
cagccagtgcctgtatctccccagccgaaacacaaagtgtccaccttggtacagagtccc
cagatcaaggctccaccgactttgtctactgagggtgtagtttttgaggagtctgtatca
gagaggctaaagtctgagacccaggagaacagaccaaaggagaagcccatctctacagct
atcaagtctgtccctgtgccaaagcagagcgctgttgcaaagctacctgctgtccatcca
gcccgtctaaggaagctgtccttcctgcccaccccacgtgctcagggtcctgaggatgtg
gtgcaggcgttcatcagtgagattgggatcgaagcatcagatctgtcgagtctgttggag
cagtttgagaagtcagaagccaaaaaggagtgtcctctcccggcttctgctgacagcttg
gctgtaggaaactcaggcattgacattccccaggagaagaagcccttagaccggttacaa
gccccagaactggccaacgtggcagggctcacccctccagctacccctccccaccagtta
tggaaacccctggctgctgtctcactcttggcgaaagccaaatctcctaaatccaccgcc
caagagggaaccctgaagcctgaaggaattacagaggccaaacctccagctacagcctgc
ctccaagaaggggcccacagccctagtccagtccatgtgggctctggggaccatgactat
tgtgtccgaagcaggacacccccaaaaaggatgcctgccctagtcatctcagaggtgggc
tcccgatggaatgtcaagcgccatcaggacatcaccatcaagcctgtgttgtcattgggc
tcagctgcacccccactcccatgcacggctacttcccaggagcctcttgatcacaggact
agcgttgagcaggcagatccttcagcgccttgttttgccccatccaccttgctgtctcct
gaggcttcaccctgccggagtgaaatgaacgctaggactccccctgagccctcagacaag
cagcagtcaatgcgctgttaccgaaaagcctgcagatcagtcagcccctcaagtaggggc
tggcaaggccgccgtggccgcagtagccgttctgtcagctctgggtccagccggaccagt
gaagcgtcctcgtcctcatcggtgtcttcctcatcccgatcccggtcccggtccaggtcc
aggtccttctccccccccaacaagaggtggcgaaggtccagctgcagttcctctggacgg
tccagaaggtgttcatcctcctcctcctcctcctcttcctcctcatcgtgcagttccaga
agccggtctccctctgtgtccccttgcaggagaagtgaccggaggcggcggtacagctct
taccgtgcaaatgaccattaccaaaggcagagagtgctacagaaggagcgtgcaatagaa
gagagaagggtggtcttcattgggaaaatacctggccgaatgactcggtcggagctgaaa
cagaggttctctgtttttggagaaattgaggagtgtaccattcattttcgtgtccaaggt
gacaactatggtttcgtcacttaccgttatgctgaagaggcatttgcagccattgagagt
ggccacaagttgcggcaggcagacgagcagccctttgatctctgctttgggggccgaagg
cagttctgcaagaggagttactctgaccttgactccaatcgggaagactttgatcctgct
cctgtaaagagcaaattcgattcacttgactttgatacattgttgaaacaggcccagaag
aacctcaggaggtaa

DBGET integrated database retrieval system