KEGG   Mus musculus (mouse): 226245
Entry
226245            CDS       T01002                                 

Symbol
Plekhs1, 9930023K05Rik
Name
(RefSeq) pleckstrin homology domain containing, family S member 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PH PH_11 PDZ_2
Other DBs
NCBI-GeneID: 226245
NCBI-ProteinID: NP_001157735
MGI: 2443041
Ensembl: ENSMUSG00000035818
UniProt: Q8BW88
Position
19; 19 D2
AA seq 474 aa
MEARPPKGPGKQFTFDYENEVHKRDYFIKSPPPQLFFSGTSWKKRLFILSQSRGTGLSLS
YYKDHQHRGSIEIDGSTVEVGINCQEKMQSVQKMFKCHPDEVMSIRTANRDYFLIGHDRE
KIKDWVSFMTPYCQGVKATHQRAEQEKLSLGDRRPVSDPSPFLGLCSIPEGIRLASPRAS
LPEHLIQKSLQRFRQAHLHQDHDFHSEPTQDTEEEYYLTPRSLEACLELENIAGPNDSGD
SIESNSPDQGFKRAESNYVSMRSLRTCLLKESTSASADDNDGQAEFQTESELGPPHQDSG
TGSDPCLSPPNSKAQTTDDQKGSASLTVVKLSILLNNIPDESQVETLNVFLSPRDAIDYL
ALVEAAGQICVARWEGPPRLGCLFYHGDHILAVNDLKPQSLEEVSLFLTRCIQKEKVKLS
IGRIPNSEKLHASPCACSLRHQLAESVQRDLPELERTPKRSPAIKKSQKEAAGE
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggaagccagacctccaaaaggcccaggcaaacaatttacatttgattatgaaaatgaa
gtccataaacgggattacttcattaagtcgccgccccctcagctcttcttctctgggacc
tcctggaaaaagcgtctttttattctgtcccagagtcggggaacgggtctcagtctttcc
tattacaaagaccatcagcacagaggttccatcgaaattgacggctccactgtagaagtt
ggtataaactgccaggaaaagatgcaatctgtgcagaagatgttcaagtgccacccagat
gaggtgatgtccatcagaactgcaaacagagactatttccttattggccatgacagggag
aagattaaagactgggtctccttcatgacaccatactgccagggtgttaaagcaacccat
cagagagcagagcaggagaagctttccctgggtgacagaaggccagtttccgaccccagt
cctttcttgggcctctgcagcatacccgagggtatcagacttgcatcaccgagggccagt
cttccagagcatttaatacaaaaaagcctccaaagattcaggcaagctcatcttcatcag
gatcatgatttccactcagaacccacccaagatacagaagaagagtactatctcactcct
cgaagtttagaagcctgtttagaattagagaatattgctggacccaatgattctggtgac
tccatcgaatccaatagtccggaccaaggtttcaagagagcggagagcaattacgtgtca
atgagatcattgagaacctgtctccttaaagaatcaacctctgcatcagccgacgacaac
gatggccaagcggaattccagacagagtcagagctggggcctccccaccaggacagcggc
acaggaagtgatccatgtctttcacctcccaattccaaagcccagaccacagatgaccaa
aaggggtccgcctcactaactgttgtgaaattgtctatattactcaacaacatccccgat
gagagccaagtggagactctgaacgtgttcctctctcctcgggatgccatcgactacctc
gctctggtagaagcagcaggacagatctgtgtggctcgctgggaaggtcctccccgacta
ggatgcttattctaccacggagatcatatcttggccgtgaatgacctgaaaccccaaagc
ctggaggaggtgtccttgtttcttacccgatgtatccagaaggagaaagtgaaactctcc
attggccggatcccaaactcagagaagctccacgcttccccctgtgcatgctccttaaga
caccagttggctgagtctgtccagcgggatttgccagaactggagaggacaccaaagagg
agccctgccatcaaaaagagtcagaaggaagctgctggggagtag

DBGET integrated database retrieval system