KEGG   Mus musculus (mouse): 226250
Entry
226250            CDS       T01002                                 

Gene name
Afap1l2, AU041783, C86904, mKIAA1914
Definition
(RefSeq) actin filament associated protein 1-like 2
  KO
K23782  actin filament associated protein 1-like
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    226250 (Afap1l2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   226250 (Afap1l2)
SSDB
Motif
Pfam: PH PH_11 Mod_r CAF-1_p150 CENP-Q TMPIT
Other DBs
NCBI-GeneID: 226250
NCBI-ProteinID: NP_001171268
MGI: 2147658
Ensembl: ENSMUSG00000025083
Vega: OTTMUSG00000028250
UniProt: Q5DTU0
Position
19; 19 D2
AA seq 825 aa
MERYKALEQLLTELDDFLKVLDQENLSSAAVLKKSGLSELLRLYTKSSSSDEEYIYMNKV
SVNGEQNSASPDKVPEEQGPLTNGEPSQHSSAPQKSLPDLPPPKMIPERKQPTVPKIESP
EGYYEEAEPFDRSINEDGEAVSSSYESYDEDENSKGKAAPYQWPSPEASIELMRDARICA
FLWRKKWLGQWAKQLCVIRDTRLLCYKSSKDHSPQLDVNLRGSSVVHKEKQVRKKGHKLK
ITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEGNQYTPDAQRLNCQKPDIAEK
YLSAAEYGITINGHPEIPETKDVKKKCSAGLKLSNLMNLGRKKSTSLEPPERSLETSSYL
NVLVNSQWKSRWCFVRDSHLHFYQDRNRSKVAQQPLSLVGCDVLPDPSPDHLYSFRILHN
GEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEELTYDYVDAERVSCIVSAAKTSLLLMQ
RKFSEPNTYIDGLPSRDCQDDLYDDVEVSELIAVVEPAEEAAPAVDANSGSEPDRVYLDL
TPVKSFLHSSSEAQAQASLPAVPHQDDVAETLTVDPKPGTTPEEPHTESPGDPEVQQRQP
EVQESSEPIEPTPRITMVKLQAEQQRISFPANCPDTMASAPIAASPPVKEKLRVTSAEIK
LGKNRTEAEVKRYTEEKERLERSKEEIRGHLAQLRREKRELKETLLRCTDKGVLAKLEQT
LKKIDEECRMEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLDNMSPRPQPKAA
TPNPPPDSTPVNSASVLKNRPLSVMVTGKGTVLQKAKEWEKKGAS
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggagcgctacaaagccctggagcagctgctgacagagctggacgacttccttaaggtc
ctcgaccaggagaacctgagcagtgcagccgtgctgaagaagagcggcctgtcagagctc
ctgcggctttacaccaagagcagcagttctgatgaggagtatatttacatgaacaaagtg
tcagtcaacggggaacaaaactcagcatctccagacaaagttcccgaggagcagggtcca
ctgaccaatggggagcccagccagcattcctcagcccctcagaagagccttccagacctc
cctccgcccaagatgattccagagaggaaacagcccaccgttccaaagatcgagtcccct
gagggctactatgaagaggctgagccatttgacagatccatcaatgaggatggagaggct
gtgagcagctcctacgagtcctacgatgaggacgagaacagcaaaggcaaggctgccccc
taccagtggccctcgcccgaggccagcattgagctgatgcgtgatgcccgcatctgtgcc
ttcctgtggcgcaagaagtggctaggccagtgggccaagcagctctgtgtgatcagggac
accaggctcttgtgctacaaatcgtccaaagaccacagtcctcagctggacgtgaacctg
cggggcagcagcgtcgtgcacaaggagaagcaagtgcggaagaaaggacacaagctcaag
atcacaccgatgaacgctgacgttatcgtgctgggcctgcagagcaaggaccaagctgag
cagtggcttcgggtcatccaggaggtgagtggcctgccttctgaaggagcctcagaggga
aaccagtacacaccagatgcccagcgcctcaactgtcagaaaccagacatagctgagaag
tacctgtcagcagcggagtacgggatcaccatcaacggccaccctgagatcccagagacc
aaagatgtcaagaagaaatgctctgctggcctcaagctgagcaaccttatgaacctgggc
aggaagaaatctacctcgctggagcccccggagagatcccttgagacatccagctacctg
aatgtgctggtgaacagtcaatggaagtcacgctggtgcttcgttagagacagccacctg
cacttctaccaggaccggaaccggagcaaggtggcccagcagcccctcagcctggtgggc
tgtgacgtgcttccagatcctagccccgaccacctgtattccttccgtattctccacaac
ggcgaggagctagccaagcttgaggccaagtcttcagaggagatgggccactggctaggc
ctcctgctctcagagtcgggctccaagactgacccggaagagctcacctacgactatgtg
gatgctgaaagggtttcctgtattgtgagtgcggccaaaacctctctcttactgatgcag
agaaagttctcagagcccaacacatacatcgatggcctgcccagccgggattgccaggac
gatctgtatgatgatgtggaggtatcagagctgatagccgtggtggagcctgccgaggaa
gccgcccctgctgtcgatgctaacagtggtagtgagccagacagagtctacctggatctc
acaccggtcaagtccttcctgcacagtagcagtgaggctcaggcgcaggcctctctccca
gcagtgccacatcaggacgatgtagctgagaccctcacagtagacccaaagccaggcacc
accccagaggagccccacacagagtctccaggagacccagaggtgcagcagaggcaacca
gaggttcaagagtcttcagagcctatcgagcccaccccgcgaatcaccatggttaagcta
caggccgagcagcagagaatctccttcccagccaactgcccagacaccatggcttctgcc
cccatcgctgccagcccacctgtgaaggagaagctgagagtgaccagtgcagagatcaaa
cttgggaagaatcggacagaggcggaagtaaagcggtacacggaggagaaggagaggctg
gagaggagcaaggaggagatccgagggcacctggctcagctccgcagagagaagcgggag
ctcaaagagaccctgttgagatgcacagataagggggtcctggccaagctggagcagaca
ctgaagaaaatagacgaggaatgccggatggaggagagcaggcgtgtggaccttgagctc
agcatcatggaggtgaaggacaacctgaagaaggcagaggctgggcccgtgaccctgggc
accactgtggataccacgcacctggacaacatgagccctcgtccacagcccaaagctgcc
acccccaaccccccaccagactccacgccagtcaactctgcatctgtgctcaagaacagg
cctctttccgtcatggtcacaggcaaaggcactgtcctgcagaaagccaaggaatgggag
aagaaaggagccagttag

DBGET integrated database retrieval system