KEGG   Mus musculus (house mouse): 226251
Entry
226251            CDS       T01002                                 
Symbol
Ablim1, 2210411C18Rik, 2610209L21Rik, 4833406P10Rik, 9330196J19Rik, AV079770, AW060987, AW215784, Limab1, mKIAA0059
Name
(RefSeq) actin-binding LIM protein 1
  KO
K07520  actin-binding LIM protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    226251 (Ablim1)
SSDB
Motif
Pfam: AbLIM_anchor LIM VHP
Other DBs
NCBI-GeneID: 226251
NCBI-ProteinID: NP_848803
MGI: 1194500
Ensembl: ENSMUSG00000025085
UniProt: Q8K4G5 E9QK41
Position
19:complement(57021165..57303776)
AA seq 861 aa
MPSLLGLKCLGKLCSSEIGKVPSPERASLRNSHRRLLIEDLSVPETPDPAHRRRGTVIHL
VYLYSAGCGPPELRFSSYDPSVAHPQDPHHSSEKPVIHCHKCGEPCKGEVLRVQTKHFHI
KCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPN
CFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKEASCSSNCAGCGRDIKNGQALL
ALDKQWHLGCFKCKSCGKVLTGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAG
DKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPPNIPRSSSDFFY
PKSLIRRTGRSPALQLLSPPCLMNSNKNPRQPTRTSSESIYSRPGSSIPGSPGHTIYAKV
DNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSA
EGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPELLSPGVHRWSPLRTS
SFSSTHSDSRPNPPFRHHFLPHVKGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPD
QGINIYRKPPIYKQHAALAAQSKASEDIIKFSKFPAAQAPDPNEIPKIETDHWPGPPSLA
AVGTDPRRRSSGREEDEEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERASLASR
YDSPLHSASHAPSSKTSSLPGYGKNGLHRPVSTDFAQYNSYGDISGGVRDYQTLPDGHMP
AVRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSI
QEFDKLPLWRRNDMKKKAKLF
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgccatccttgcttgggttaaagtgtctggggaaattgtgcagctctgagataggcaaa
gttccctcaccagagagagccagcctcaggaactcccacaggagactgcttattgaggac
ctgagtgtccccgagactcctgaccctgctcatcgcaggcgtggcacagtcatacatctg
gtctatctgtattctgctggctgtggtccaccagagctcaggtttagcagctatgatcca
tccgtggcccatcctcaggaccctcaccactcgtcggagaaacctgtcattcactgccat
aaatgcggggagccatgcaagggcgaagtgctacgggtgcagaccaagcatttccacatc
aaatgcttcacctgcaaagtgtgcggctgcgacctggcccaggggggcttcttcataaag
aacggggactatctgtgtaccctggactaccagaggatgtatgggacacggtgccacggc
tgtggggagttcgtggagggcgaggtggtaactgccctgggcaagacctaccaccccaac
tgcttcgcctgtacaatctgcaagcgcccatttccacccggagaccgagtcacattcaac
gggagagactgtctttgtcagctctgtgcacagccgatgtcttccagccctaaagaagcc
tcctgctccagcaactgcgccggctgtggaagggacattaagaacggacaggcgctgcta
gctctggacaagcagtggcatttgggctgcttcaagtgcaagtcctgtgggaaggtcctc
accggcgagtacatcagcaaggatggctccccatactgtgagaaagactaccaggggctc
tttggggtgaagtgtgaagcctgtcaccagtttatcacaggaaaagtcctggaggcaggc
gacaagcattatcatcccagctgcgcacgatgcagcagatgcaatcagatgttcacagaa
ggggaagaaatgtatctgcaaggttctaccgtgtggcatcccgactgtaagcagtccact
aagacagaggagaagctgcggccaccaaacatcccgcgctcttcatccgatttcttttac
cccaaaagtctgattcgtcgcacaggacggtccccagctctgcagcttctgtcgccaccc
tgtctgatgaactccaacaaaaaccccaggcagcccaccaggacctcctctgaaagtatc
tattctagaccaggctccagcatccctggttcaccaggccatactatctatgcaaaagta
gacaatgaaatcctggattacaaggatttagcagccatccccaaggtcaaggcgatctat
gacatcgagcgtccagatctcattacctatgagcctttctacacatcaggctatgaggac
aagcaggagagacagagccttggagagtctccaaggactttgtctccaactccatctgca
gaaggttatcaagatgtccgggatcggatgatccacaggtccaccagccagggctccatc
aactcccctgtgtatagccggcacagttacactccaactacgtctcgctcgccccagcac
ttccaccgacctgagctcttgtctcctggtgtgcacaggtggtctcccctgcgcaccagc
agcttcagctccacccacagcgactcccgtcccaacccccccttccgacaccacttcctc
ccccatgtcaaaggcaatgagccgtccagcggccggaactcccctctcccctaccggccc
gacagccgccctctaactccaacttacgctcaggcccctaaacatttccatgttccagat
caagggatcaacatttaccgaaaaccacccatctacaaacagcatgctgccttggcagcc
cagagcaaggcttcagaagatatcatcaagttttccaagttcccagcagcccaggcgcca
gatcccaacgagataccaaagattgagacggaccactggccgggtcccccctcacttgcc
gccgtaggaactgacccgaggcgcagatcaagtggcagagaggaagatgaagaggagctt
ttgagacgccggcagcttcaagaagaacagttgatgaagctcaactcaggcctggggcag
ctgatcctgaaggaagagatggagaaggagagcagagaaagagcatcgctggccagtcgc
tatgactctcccctccactcagcttcccatgctccatcatctaaaacttcatctctccct
ggttatggaaagaatggccttcaccggccagtttccacagacttcgctcagtacaacagc
tacggagacatcagtggcggagttcgagactaccagaccctcccagatggccacatgcct
gcagtgagaatggacagaggagtatccatgcccaacatgttggaaccaaagatatttcca
tatgagatgctcatggtgaccaacagagggcgcaacaaaatcctgagagatgtggataga
acccggctagagcgccacttagccccagaagtattttgggagatctttgggatgtccata
caggaatttgacaagttacctctttggagacgcaacgacatgaagaaaaaagctaaactc
ttctaa

DBGET integrated database retrieval system