KEGG   Mus musculus (mouse): 22627
Entry
22627             CDS       T01002                                 

Gene name
Ywhae, AU019196
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
  KO
K06630  14-3-3 protein epsilon
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05160  Hepatitis C
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    22627 (Ywhae)
   04151 PI3K-Akt signaling pathway
    22627 (Ywhae)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22627 (Ywhae)
   04114 Oocyte meiosis
    22627 (Ywhae)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22627 (Ywhae)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    22627 (Ywhae)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22627 (Ywhae)
  09172 Infectious disease: viral
   05160 Hepatitis C
    22627 (Ywhae)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22627 (Ywhae)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22627 (Ywhae)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    22627 (Ywhae)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22627 (Ywhae)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 22627
NCBI-ProteinID: NP_033562
MGI: 894689
Ensembl: ENSMUSG00000020849
Vega: OTTMUSG00000006219
UniProt: P62259 Q5SS40
Position
11 B5; 11 45.92 cM
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggcagagcaggccgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcagggatggacgtggagctgacagttgaa
gaacgaaaccttttatctgttgcatataaaaatgtgattggagccagaagagcatcctgg
agaataatcagcagcattgaacagaaggaagaaaacaagggaggagaggacaaattaaag
atgattcgggagtaccggcaaatggttgaaactgagctcaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgagtttgccacaggaaatgac
aggaaggaggcagcagagaacagcctcgtggcttacaaagctgctagtgacattgcgatg
acagaacttcctccaacgcaccccattcgtttaggtcttgctctcaacttttccgtattc
tactatgaaattcttaattcccccgaccgtgcctgcaggttggcaaaagcagcttttgat
gacgcaattgcagaactggacacgctgagtgaagaaagctataaggactctacgctcatc
atgcagctgctacgtgataacctgacgctgtggacctcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgagaatcagtga

DBGET integrated database retrieval system