KEGG   Mus musculus (mouse): 22627
Entry
22627             CDS       T01002                                 

Gene name
Ywhae, AU019196
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
  KO
K06630  14-3-3 protein epsilon
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05160  Hepatitis C
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    22627 (Ywhae)
   04151 PI3K-Akt signaling pathway
    22627 (Ywhae)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22627 (Ywhae)
   04114 Oocyte meiosis
    22627 (Ywhae)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22627 (Ywhae)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    22627 (Ywhae)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22627 (Ywhae)
  09172 Infectious disease: viral
   05160 Hepatitis C
    22627 (Ywhae)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22627 (Ywhae)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22627 (Ywhae)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    22627 (Ywhae)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22627 (Ywhae)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 22627
NCBI-ProteinID: NP_033562
MGI: 894689
Ensembl: ENSMUSG00000020849
Vega: OTTMUSG00000006219
UniProt: P62259 Q5SS40
Position
11 B5; 11 45.92 cM
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggcagagcaggccgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcagggatggacgtggagctgacagttgaa
gaacgaaaccttttatctgttgcatataaaaatgtgattggagccagaagagcatcctgg
agaataatcagcagcattgaacagaaggaagaaaacaagggaggagaggacaaattaaag
atgattcgggagtaccggcaaatggttgaaactgagctcaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgagtttgccacaggaaatgac
aggaaggaggcagcagagaacagcctcgtggcttacaaagctgctagtgacattgcgatg
acagaacttcctccaacgcaccccattcgtttaggtcttgctctcaacttttccgtattc
tactatgaaattcttaattcccccgaccgtgcctgcaggttggcaaaagcagcttttgat
gacgcaattgcagaactggacacgctgagtgaagaaagctataaggactctacgctcatc
atgcagctgctacgtgataacctgacgctgtggacctcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgagaatcagtga

KEGG   Mus musculus (mouse): 22628
Entry
22628             CDS       T01002                                 

Gene name
Ywhag, 14-3-3gamma, D7Bwg1348e
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
  KO
K16198  14-3-3 protein gamma/eta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu05160  Hepatitis C
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    22628 (Ywhag)
   04151 PI3K-Akt signaling pathway
    22628 (Ywhag)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22628 (Ywhag)
   04114 Oocyte meiosis
    22628 (Ywhag)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22628 (Ywhag)
  09172 Infectious disease: viral
   05160 Hepatitis C
    22628 (Ywhag)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    22628 (Ywhag)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22628 (Ywhag)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22628 (Ywhag)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     22628 (Ywhag)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    22628 (Ywhag)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22628 (Ywhag)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 22628
NCBI-ProteinID: NP_061359
MGI: 108109
Ensembl: ENSMUSG00000051391
Vega: OTTMUSG00000016297
UniProt: P61982 A8IP69
Position
5; 5 G2
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgatatggccgcggccatgaagaacgtgaccgagctgaacgaaccactgtccaatgag
gaacggaacctcctgtcggtggcctacaagaacgtggtgggggctcgccgctcctcctgg
agggtcatcagcagcatcgagcagaagacgtctgcggacggcaacgagaagaagatcgag
atggtccgagcctaccgggagaagatcgagaaggagctggaggccgtgtgccaggacgtg
ctgagcctgctggacaactacctgatcaagaactgcagcgagacccagtacgagagcaag
gtgttctacctgaagatgaaaggggactattaccgttacctggcagaagtggccaccggg
gagaagagggcgaccgtggtggagtcgtctgagaaggcctacagcgaagcccacgagatc
agcaaggagcacatgcagcccacccaccccatccggctgggcctggcgctcaactactcg
gttttctactatgagatccagaacgccccggagcaagcgtgccacctggccaagaccgcc
ttcgacgacgccatcgccgagctcgacactctgaacgaggactcctacaaggactccact
ctgatcatgcagctgctccgagacaacctcacgctctggacgagcgaccagcaagacgac
gacggcggtgaaggcaacaactaa

KEGG   Mus musculus (mouse): 22629
Entry
22629             CDS       T01002                                 

Gene name
Ywhah
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
  KO
K16198  14-3-3 protein gamma/eta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu05160  Hepatitis C
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    22629 (Ywhah)
   04151 PI3K-Akt signaling pathway
    22629 (Ywhah)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22629 (Ywhah)
   04114 Oocyte meiosis
    22629 (Ywhah)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22629 (Ywhah)
  09172 Infectious disease: viral
   05160 Hepatitis C
    22629 (Ywhah)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    22629 (Ywhah)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22629 (Ywhah)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22629 (Ywhah)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     22629 (Ywhah)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    22629 (Ywhah)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22629 (Ywhah)
SSDB
Motif
Pfam: 14-3-3 DUF722 CodY
Other DBs
NCBI-GeneID: 22629
NCBI-ProteinID: NP_035868
MGI: 109194
Ensembl: ENSMUSG00000018965
Vega: OTTMUSG00000016346
UniProt: P68510
Structure
PDB: 
5YQG

Position
5; 5 B1
AA seq 246 aa
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggggatcgagagcagctgctgcagcgggcgcgactggcggagcaggcggagcgctac
gacgatatggcctccgccatgaaggcggtgacagagctgaatgaaccactatctaacgaa
gatcgaaatctcctctctgtggcctacaagaatgtagttggtgccaggcgatcttcttgg
agggttattagtagcattgagcagaaaaccatggcagatgggaatgagaagaagttggag
aaagttaaagcctaccgggagaagattgaaaaggagctggagacagtttgcaatgatgtc
ttggctctgcttgacaagttccttatcaagaactgcaatgattttcagtatgagagcaag
gtgttctacctgaaaatgaagggcgattactaccgctacctggcagaggtggcttctggg
gagaagaaaaacagtgtggttgaagcttctgaggccgcgtataaggaagccttcgaaatc
agcaaagagcacatgcagccaacacaccccatccggcttggcctggccctcaatttttct
gtgttctactatgagatccagaatgcaccagagcaagcctgcctcttagccaaacaagcc
ttcgatgatgctatagctgagctggacacattaaacgaggattcctataaggactccact
ctcatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaa
gaagcaggagaaggcaactga

KEGG   Mus musculus (mouse): 22630
Entry
22630             CDS       T01002                                 

Gene name
Ywhaq, 2700028P07Rik, AA409740, AU021156, R74690
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    22630 (Ywhaq)
   04151 PI3K-Akt signaling pathway
    22630 (Ywhaq)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22630 (Ywhaq)
   04114 Oocyte meiosis
    22630 (Ywhaq)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22630 (Ywhaq)
  09172 Infectious disease: viral
   05161 Hepatitis B
    22630 (Ywhaq)
   05160 Hepatitis C
    22630 (Ywhaq)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22630 (Ywhaq)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22630 (Ywhaq)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    22630 (Ywhaq)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22630 (Ywhaq)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 22630
NCBI-ProteinID: NP_035869
MGI: 891963
Ensembl: ENSMUSG00000076432
Vega: OTTMUSG00000016335
UniProt: P68254 A3KML3
Position
12; 12 A1.3
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagaccgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaagccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctgtcggtggcctacaaaaacgtggtagggggccgcaggtccgcctggagg
gtcatctcgagcattgagcagaagaccgacacctctgacaagaagttgcagctgatcaag
gactatcgggagaaagtggagtcggagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtatcttgctgaagtagcttgtggcgatgatcgaaaacaa
acaatagaaaattcccaaggagcctaccaagaggcgtttgatataagcaagaaggagatg
cagcctacgcatccaatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataatccagagcttgcctgcacactggctaaaacggcttttgatgaggccatc
gcagagcttgatacactgaacgaagactcctacaaagacagcaccctcatcatgcagttg
cttagagacaacttaacattatggacatcagacagtgcaggagaagaatgtgatgcagca
gagggggccgaaaactaa

KEGG   Mus musculus (mouse): 22631
Entry
22631             CDS       T01002                                 

Gene name
Ywhaz, 1110013I11Rik, 14-3-3zeta, AI596267, AL022924, AU020854
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    22631 (Ywhaz)
   04151 PI3K-Akt signaling pathway
    22631 (Ywhaz)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22631 (Ywhaz)
   04114 Oocyte meiosis
    22631 (Ywhaz)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22631 (Ywhaz)
  09172 Infectious disease: viral
   05161 Hepatitis B
    22631 (Ywhaz)
   05160 Hepatitis C
    22631 (Ywhaz)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22631 (Ywhaz)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22631 (Ywhaz)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    22631 (Ywhaz)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22631 (Ywhaz)
SSDB
Motif
Pfam: 14-3-3 AAA_15 CSN7a_helixI FliM
Other DBs
NCBI-GeneID: 22631
NCBI-ProteinID: NP_001240734
MGI: 109484
Ensembl: ENSMUSG00000022285
Vega: OTTMUSG00000017005
UniProt: P63101
Position
15; 15 B3.1
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaagctggccgagcaggcagagcgatatgat
gacatggcagcctgcatgaagtctgtcactgagcagggagctgagctgtcgaatgaggag
agaaaccttctctctgttgcttataaaaacgttgtaggagcccgtaggtcatcgtggagg
gtcgtctcaagtattgagcagaagacggaaggtgctgagaaaaagcagcagatggctcga
gaatacagagagaagatcgagacggagctgcgtgacatctgcaacgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcgcaaccagaaagcaaagtcttctatttgaaa
atgaagggtgactactaccgttacttggccgaggttgctgctggtgatgacaagaaagga
attgtggaccagtcacagcaagcataccaagaagcatttgaaatcagcaaaaaggagatg
cagccgacacaccccatcagactgggtctggccctcaacttctctgtgttctattacgag
atcctgaactccccagagaaagcctgctctcttgcaaaaacagctttcgatgaagccatt
gctgaacttgatacattaagtgaagagtcgtacaaagacagcacgctaataatgcagtta
ctgagagacaacttaacattgtggacatcggatacccaaggagatgaagcagaagcagga
gaaggaggggaaaattaa

KEGG   Mus musculus (mouse): 54401
Entry
54401             CDS       T01002                                 

Gene name
Ywhab, 1300003C17Rik, 14-3-3b
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    54401 (Ywhab)
   04151 PI3K-Akt signaling pathway
    54401 (Ywhab)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    54401 (Ywhab)
   04114 Oocyte meiosis
    54401 (Ywhab)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    54401 (Ywhab)
  09172 Infectious disease: viral
   05161 Hepatitis B
    54401 (Ywhab)
   05160 Hepatitis C
    54401 (Ywhab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    54401 (Ywhab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    54401 (Ywhab)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    54401 (Ywhab)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   54401 (Ywhab)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98 FliM SF3A2
Other DBs
NCBI-GeneID: 54401
NCBI-ProteinID: NP_061223
MGI: 1891917
Ensembl: ENSMUSG00000018326
Vega: OTTMUSG00000016138
UniProt: Q9CQV8 A2A5N2
Structure
PDB: 
5WFX 5WFU 5F74 4GNT

Position
2; 2 H3
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFY
LKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataagagtgagctggtacagaaagccaaactggctgagcaggctgagcgc
tatgatgacatggctgcagctatgaaggccgtaacagagcagggacacgaactctccaat
gaagagaggaatctactctctgttgcctacaagaacgtggtaggtgcccgccgctcttcc
tggcgtgtcatctccagcatcgaacagaaaaccgagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatcgaggcggagctgcaggacatctgcaacgatgtgctg
gagctgttggacaaatatctcattctcaatgccacccaggcagaaagcaaagtgttctac
ttaaaaatgaaaggagactactttaggtatctttctgaagttgcatccggagaaaataaa
caaaccacggtgtccaactcccagcaggcttaccaagaagcatttgaaatcagcaagaaa
gaaatgcagcctacacacccgattcgcctcggcctggcgctgaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgcagcctggccaaaacggcatttgatgag
gcgattgctgagttggacaccctgaatgaagagtcttacaaagacagcaccctgatcatg
cagctgctcagggacaatctcaccctgtggacgtcagaaaaccagggggatgaaggagat
gctggagagggagagaactaa

DBGET integrated database retrieval system