KEGG   Mus musculus (mouse): 22628
Entry
22628             CDS       T01002                                 

Symbol
Ywhag, 14-3-3gamma, D7Bwg1348e
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
  KO
K16198  14-3-3 protein gamma/eta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu05160  Hepatitis C
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    22628 (Ywhag)
   04151 PI3K-Akt signaling pathway
    22628 (Ywhag)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22628 (Ywhag)
   04114 Oocyte meiosis
    22628 (Ywhag)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22628 (Ywhag)
  09172 Infectious disease: viral
   05160 Hepatitis C
    22628 (Ywhag)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    22628 (Ywhag)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22628 (Ywhag)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22628 (Ywhag)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     22628 (Ywhag)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    22628 (Ywhag)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22628 (Ywhag)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 22628
NCBI-ProteinID: NP_061359
MGI: 108109
Ensembl: ENSMUSG00000051391
Vega: OTTMUSG00000016297
UniProt: P61982 A8IP69
Position
5; 5 G2
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgatatggccgcggccatgaagaacgtgaccgagctgaacgaaccactgtccaatgag
gaacggaacctcctgtcggtggcctacaagaacgtggtgggggctcgccgctcctcctgg
agggtcatcagcagcatcgagcagaagacgtctgcggacggcaacgagaagaagatcgag
atggtccgagcctaccgggagaagatcgagaaggagctggaggccgtgtgccaggacgtg
ctgagcctgctggacaactacctgatcaagaactgcagcgagacccagtacgagagcaag
gtgttctacctgaagatgaaaggggactattaccgttacctggcagaagtggccaccggg
gagaagagggcgaccgtggtggagtcgtctgagaaggcctacagcgaagcccacgagatc
agcaaggagcacatgcagcccacccaccccatccggctgggcctggcgctcaactactcg
gttttctactatgagatccagaacgccccggagcaagcgtgccacctggccaagaccgcc
ttcgacgacgccatcgccgagctcgacactctgaacgaggactcctacaaggactccact
ctgatcatgcagctgctccgagacaacctcacgctctggacgagcgaccagcaagacgac
gacggcggtgaaggcaacaactaa

DBGET integrated database retrieval system