KEGG   Mus musculus (mouse): 22631Help
Entry
22631             CDS       T01002                                 

Gene name
Ywhaz, 1110013I11Rik, 14-3-3zeta, AI596267, AL022924, AU020854
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    22631 (Ywhaz)
   04151 PI3K-Akt signaling pathway
    22631 (Ywhaz)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22631 (Ywhaz)
   04114 Oocyte meiosis
    22631 (Ywhaz)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22631 (Ywhaz)
  09172 Infectious disease: viral
   05161 Hepatitis B
    22631 (Ywhaz)
   05160 Hepatitis C
    22631 (Ywhaz)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22631 (Ywhaz)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22631 (Ywhaz)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    22631 (Ywhaz)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22631 (Ywhaz)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 AAA_15 CSN7a_helixI FliM Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 22631
NCBI-ProteinID: NP_001240734
MGI: 109484
Ensembl: ENSMUSG00000022285
Vega: OTTMUSG00000017005
UniProt: P63101
Position
15; 15 B3.1
AA seq 245 aa AA seqDB search
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaagctggccgagcaggcagagcgatatgat
gacatggcagcctgcatgaagtctgtcactgagcagggagctgagctgtcgaatgaggag
agaaaccttctctctgttgcttataaaaacgttgtaggagcccgtaggtcatcgtggagg
gtcgtctcaagtattgagcagaagacggaaggtgctgagaaaaagcagcagatggctcga
gaatacagagagaagatcgagacggagctgcgtgacatctgcaacgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcgcaaccagaaagcaaagtcttctatttgaaa
atgaagggtgactactaccgttacttggccgaggttgctgctggtgatgacaagaaagga
attgtggaccagtcacagcaagcataccaagaagcatttgaaatcagcaaaaaggagatg
cagccgacacaccccatcagactgggtctggccctcaacttctctgtgttctattacgag
atcctgaactccccagagaaagcctgctctcttgcaaaaacagctttcgatgaagccatt
gctgaacttgatacattaagtgaagagtcgtacaaagacagcacgctaataatgcagtta
ctgagagacaacttaacattgtggacatcggatacccaaggagatgaagcagaagcagga
gaaggaggggaaaattaa

DBGET integrated database retrieval system