KEGG   Mus musculus (mouse): 22632
Entry
22632             CDS       T01002                                 

Gene name
Yy1, NF-E, NF-E1, YY-1
Definition
(RefSeq) YY1 transcription factor
  KO
K09201  transcription factor YY
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22632 (Yy1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    22632 (Yy1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    22632 (Yy1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    22632 (Yy1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     22632 (Yy1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    22632 (Yy1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 IBR Raffinose_syn
Other DBs
NCBI-GeneID: 22632
NCBI-ProteinID: NP_033563
MGI: 99150
Ensembl: ENSMUSG00000021264
Vega: OTTMUSG00000017257
UniProt: Q00899
Position
12 F1; 12 59.58 cM
AA seq 414 aa
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
GGGGGHGHAGHHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDS
DGLRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGASSGGGRVKKGGGKKS
GKKSYLGGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcctcgggcgacaccctctacatcgccacggacggctcggagatgccggccgagatc
gtggagctgcatgagatcgaggtggagaccatcccggtggagaccatcgagaccacggtg
gtgggcgaggaggaggaggaggacgacgacgacgaggacggcggcggcggcgaccacggc
ggcggcgggggcggccacgggcacgccggccaccaccatcaccaccaccaccaccaccac
caccacccgcccatgatcgcgctgcagccgctggtgacggacgacccgacccaagtgcac
caccaccaggaggtgatcctggtgcagacgcgcgaggaggtggtcggcggggacgactcg
gacgggctgcgcgccgaggacggcttcgaggaccagatcctcatcccggtgcccgcgccg
gccggcggcgacgacgactacatagagcagacgctggtcaccgtggcggcggccggcaag
agcggcggcggggcctcgtcgggcggcggtcgcgtgaagaagggcggcggcaagaagagc
ggcaagaagagttacctgggcggcggggccggcgcggcgggcggcggcggcgccgacccg
gggaataagaagtgggagcagaagcaggtgcagatcaagaccctggagggcgagttctcg
gtcaccatgtggtcctcggatgaaaaaaaagatattgaccatgaaacagtggttgaagag
cagatcattggagagaactcacctcctgattattctgaatatatgacaggcaagaaactc
cctcctggagggatacctggcattgacctctcagaccctaagcaactggcagaatttgcc
agaatgaagccaagaaaaattaaagaagatgatgctccaagaacaatagcttgccctcat
aaaggctgcacaaagatgttcagggataactctgctatgagaaagcatctgcacacccac
ggtcccagagtccacgtctgtgcagagtgtggcaaagcgttcgttgagagctcaaagcta
aaacgacaccagctggttcatactggagaaaagccctttcagtgcacattcgaaggctgc
gggaagcgcttttcactggacttcaatttgcgcacacatgtgcgaatccataccggagac
aggccctatgtgtgccccttcgacggttgtaataagaagtttgctcagtcaactaacctg
aaatctcacatcttaacacacgctaaagccaaaaacaaccagtga

DBGET integrated database retrieval system