KEGG   Mus musculus (house mouse): 22635
Entry
22635             CDS       T01002                                 
Symbol
Zan, Zan-test
Name
(RefSeq) zonadhesin
  KO
K24831  zonadhesin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    22635 (Zan)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Others
   22635 (Zan)
SSDB
Motif
Pfam: TILa VWD TIL MAM VWC
Other DBs
NCBI-GeneID: 22635
NCBI-ProteinID: NP_035871
MGI: 106656
Ensembl: ENSMUSG00000079173
UniProt: E9PWQ7
Position
5:complement(137376899..137475326)
AA seq 5420 aa
MALPVWTLMLLVGAAWGQEQVPAWRPNSPDLGPMVHTSREDSILSKCDFEDNSRPFCDWS
QMSADDGDWIRTTGPSLTGTSGPPGGYPNGEGYYLHMDPKTFPQGGVARLRSPDIWEQGP
LCVHFAFHMFGLSWGAQLRLLLLRGRKHLRPYVLWKHVNTQSPSWMPTTVTVPADHDIPS
WLMFEGMRGNTAYLDISLDGLSIQRGTCNQVCMSQMCTFDTLNDLCGWSWVPTATGAKWT
QKKGPTGKQGVGPAEDFSNPGNGYYMLLDSTNARPGQKAVLLSPLSHSRGCMTLSFHYIM
HGQGHEEGLFVYATFLGNIRKYTLFSGHPGPDWQAVSVNYTGQGQIQFMVVGMFGNIPEP
AIAVDAISIAPCGESFPQCDFEDRVHPFCDWNQVYGDMGHWSWGSKSVPTLIAGSPREFP
YGGEHYIFFDSVKLSQEGQSARLVSPPFCAPGDICVEFAYHMYGLGKGTTLKLLLGSPAG
SFPIPLWNRVGSQSSGWMNSSVTIPKGYQQPMQLFIEATRGTSTAFVVALNFILISHGPC
RVLLQTEIPSSPLLPPTGPSESTVPTLPMEQPTSPTKATTVTIEIPTTPTEEATIPTETT
TVPTEVINVSPKETSIPPEVTIPTEVITVSPEEIISPTEVTPVPTDVTAAYVEATNASPE
ETSVPPEVTILTEVTTVSPEETTVPTEVPIVLIEATAFPTGETTLYTEVPTVPTEVTGVH
TEVTNVSPEETSVPTEETISTEVTTVSPEETTLPTEVPTVSTEVTNVSPEETSVPPEETI
LTTLYTEVPTVPTEVTGVHTEVTNVSPEETSVPTEETISTEVTTVSPEETTLPTEVPTVS
TEVTNVSPEETSVPPEETILTEITTVSPEETVFPIEGTTLPTEVLTVPIEVTTFPTGETT
VPTEVPTVSTEMTGVHTEVTTVFPEETSIPTEVATVLPASIPPEETTTPTEVTTTPPEET
TIPAEVTTIPPVSIPSEETTTPTEVTTTPPEETTIPAEVTTVPPVSIPSEETTTPTEVTT
TPPEETTIPAEVTTVPPVSIPSEETTIPTEVTTVPPEETTIPAEVTTTPPEETTIPTEVT
TVPPASIPPEETASLTEVTTTPPEETTTPTEVTTVPPEKTTIPTEVTTVPPASIFPEETT
VPPEETTIASEETTVSTQETTLLTEQSAVTQTSIACRPPCPSPPLMPIGPLLSKPPGVSM
FSLAPTTGVSTTESCPPNAHIELCACPASCESPKPSCQPPCIPGCVCNPGFLFSNNQCIN
ESSCNCPYNNKYYKPGEEWFTPNCTERCRCLPGSLMECQISQCGTHTVCQLKSDQYQCEP
YGKATCLVYGDLHFVTFDERHIGFTGTCTYILTQTCSNSTDHFFRITANTEERGVEGVSC
LDKVVISLPETTVTMISGRHTLIGDQEVTLPAILSDDTYVGLSGRFVELRTTFGLRVRWD
GDQQLFVTVSSTFSGKLCGFCGNYDGDSSNDNLKSDGMMTHDEEELRLSWQVEEDEDKDW
VSSRCQKKKNPPSCDAALGSTMSGPKLCGQLVNPSGPFEACLLHLKASSFLDNCVTDMCS
FQGLQQKLCAHMSAMTATCQDAGYPVKPWREPQFCPLVCPKNSRYSLCAKPCPETCHPIS
TTQHCSDKCVEGCECDPGFILSGSECVPSSQCGCTSFQGRYFKLQEQWFNPDCKEICTCE
SHNHILCKPWKCKAQEACSYKNGVLGCHAQGAATCMVSGDPHYLTFDGALHHFMGTCTYV
LTQPCWSKSQENNFVVSATNEIHDGNLEVSYVKAVHVQVFDLKISMFKGQKVVLNNQRVV
LPVWPSQGRVTIRLSGIFVLLYTNFGLQVRYDGRHLVEVTVPSSYTGSLCGLCGNYNNNS
MDDNLRVDMKPAGNSLLLGAAWKILEASDPGCFLVGGKPSRCADSDMDDVWTKKCAILMN
PLGPFSNCHEAVPPQASFSSCVYGQCETNGDNLTLCHSLQAYASLCAQAGQVTTWRNSTF
CPMRCPPRSSYNPCANSCPATCLTLSTPRDCPTLPCVEGCECQSGHILSGTTCVPLRQCG
CSDQDGSYHLLGESWYTEKTCTTLCTCSAHSNITCSPTACKANHVCLRQEGLLRCAAEMG
ECRISEDSQIVSFDDHSHPIQDTCTYILVKVCHPNTNMPFFMISAKTDINTNGKNKTFGV
YQLYIDIFNFHITLQKDHLVLISLINDSIVTLPTTTHIPGVSVMTEDVYTIVTIKDEIQV
KFESNNFLDVKIPASSNGKVCGVCGNFNGEEEDELMTPSGELAEDEQEFMNSWKDKSMDP
NCQKIEGQNLQVEQQEIMNGKCRPIDFEKAQANCQTALQGPAWAHCSSRVPIKPFLLKCM
NSFCEFRELFRALCDSLQSFEDACQNQGLKPPIWRNSSFCPLECPAHSHYTNCLPSCPPS
CLDPDSRCEGSGHKVPATCREGCICQPDYVLLNDKCVLRSHCGCKDAQGVFIPAGKTWIS
EDCTQSCTCMKGSMRCWDFQCPPGTYCKNSNDGSSNCVKISLQCPAHSKFTDCLPPCHPS
CSDPDGHCEGISTNAHSNCKEGCVCQPGYVLRNDKCVLRIECGCQHTQGGFIPAGKSWTS
RGCSQSCDCMEGVIRCQNFQCPSGTYCQDIEDGTSNCANITLQCPAHSSFTNCLPPCQPS
CSDPEGHCGGSTTKAPSACQEGCVCEPDYVVLNNKCVPRIECGCKDAQGVLIPADKIWIN
KGCTQTCACVTGTIHCRDFQCPSGTYCKDIKDDTSNCTEITLQCPDHSLYTHCLPSCLPS
CSDPDGLCRGTSPEAPSTCKEGCVCEPDYVLSNDKCVLRIECGCKDAQGVLIPAGKTWIN
RGCTQSCSCMGGAIQCQNFKCPSEAYCQDLEDGNSNCTSIPLQCPAHSHYTNCLPTCQPS
CSDPDGHCEGSSTKAPSACKEGCVCEPDYVMLNNKCVPRIECGCKDTQGVLIPADKTWIN
RGCTQSCTCKGGAIQCQKYHCSSGTYCKDMEDDSSSCATITLQCPAHSHFTNCLPPCQPS
CLDSEGHCEGSTTKAPSACQEGCVCEPDYVVLNNKCVPRIECGCKDAQGVLIPADKTWIN
RGCTQSCTCKGGAIQCQKFQCPSETYCKDIEDGNSNCTRISLQCPANSNFTSCLPSCQPS
CSNTDVHCEGSSPNALSSCREGCVCQSGYVLHNDKCILRNQCGCKDAQGALIPEGKTWIT
SGCTQSCNCTGGAIQCQNFQCPLKTYCKDLKDGSSNCTNIPLQCPAHSHYTNCLPSCPPS
CLDPEGLCEGTSPKVPSTCREGCICQPGYLMHKNKCVLRIFCGCKNTQGAFISADKTWIS
RGCTQSCTCSAGAIHCRNFKCPSGTYCKNGDNGSSNCTEITLQCPTNSQFTDCLPSCVPS
CSNRCEVTSPSVPSSCREGCLCNHGFVFSEDKCVPRTQCGCKDARGAIIPAGKTWTSKGC
TQSCACVEGNIQCQNFQCPPETYCKDNSEGSSTCTKITLQCPAHTQYTSCLPSCLPSCLD
PEGLCKDISPKVPSTCKEGCVCQSGYVLNSDKCVLRAECDCKDAQGALIPAGKTWTSPGC
TQSCACMGGAVQCQSSQCPPGTYCKDNEDGNSNCAKITLQCPAHSLFTNCLPSCLPSCLD
PDGLCKGASPKVPSSCKEGCICQSGYVLSNNKCLLRNRCGCKDAHGALIPEDKTWVSRGC
TQSCVCTGGSIQCLSFQCPPGAYCKDNEDGSSNCARIPPQCPANSHYTDCFPPCPPSCSD
PEGHCEASGPRVPSTCREGCLCNPGFVLDRDKCVPRVECGCKDAQGALIPSGKTWTSPGC
TQSCACMGGVVQCQSSQCPPGTYCKDNEDGNSNCAKITLQCPTHSNYTDCLPFCLPSCLD
PSALCGGTSPKGPSTCKEGCVCQPGYVLDKDKCILKIECGCRDTQGAVIPAGKTWLSTGC
IQSCACVEGTIQCQNFQCPPGTYCNHNNNCAKIPLQCPAHSHFTSCLPSCPPSCANLDGS
CEQTSPKVPSTCKEGCLCQPGYFLNNGKCVLQTHCDCKDAEGGLVPAGKTWTSKDCTQSC
ACTGGAVQCQNFQCPLGTYCKDSGDGSSNCTKIHKGAMGDGVLMAGGIRALQCPAHSHFT
SCLPSCPPSCSNLDGSCVESNFKAPSVCKKGCICQPGYLLNNDKCVLRIQCGCKDTQGGL
IPAGRTWISSDCTKSCSCMGGIIQCRDFQCPPGTYCKESNDSSRTCAKIPLQCPAHSHYT
NCLPACSRSCTDLDGHCEGTSPKVPSPCKEGCLCQPGYVVHNHKCVLQIHCGCKDAQGGF
VPAGKTWISRGCTQSCACVGGAVQCHNFTCPTGTQCQNSSCSKITVQCPAHSHYTTCLPS
CLPSCFDPEGLCGDASPRAPPTCREGCVCEADYVLREDKCVLRTQCGCKDAQGDLIPANK
TWLTRGCAQKCTCKGGNIHCWNFKCPLGTECKDSVDGGSNCTKIALQCPAHSHHTYCLPS
CIPSCSNVNDRCESTSLQRPSTCIEGCLCHSGFVFSKDKCVPRTQCGCKDSQGTLIPAGK
NWITTGCSQRCTCTGGLVQCHDFQCPSGAECQDIEDGNSNCVEITVQCPAHSHYSKCLPP
CQPSCSDPDGHCEGTSPEAPSTCEEGCVCEPDYVLSNDKCVPSSECGCKDAHGVLIPESK
TWVSRGCTKNCTCKGGTVQCHDFSCPTGSRCLDNNEGNSNCVTYALKCPAHSLYTNCLPS
CLPSCSDPEGLCGGTSPEVPSTCKEGCFCQSGYVLHKNKCMLRIHCDCKDFQGSLIKTGQ
TWISSGCSKICTCKGGFFQCQSYKCPSGTQCEESEDGSSNCVSSTMKCPANSLYTHCLPT
CLPSCSNPDGRCEGTSHKAPSTCREGCVCQPGYLLNKDTCVHKNQCGCKDIRGNIIPAGN
TWISSDCTQSCACTDGVIQCQNFVCPSGSHCQYNEDGSSDCAANKLERCTIFGDPYYLTF
DGFTYHFLGRMNYYLIKTVDKLPRGIEPLIMEGRNKISPKGSSTLHEVTTIVYGYKIQLQ
EELVVLVNDEKVAVPYNPNEHLRVMLRAQRLLLVTDFEMVLDFDGKHSAVISLPTTYRGL
TRGLCGNYDRDQSNELMLPSGVLTSNVHVYGNSWEVKAQHAFFRFPRALPEEEERDEEPD
LLQSECSQEQTALISSTQACRVLVDPQGPFAACHQIIAPEPFEQRCMLDMCTGWKTKEEE
ELRCRVLSGYAIICQEAGANMTGWRDHTHCAMTCPANTVYQRCMTPCPASCAKFVTPKVC
EGPCVEGCASLPGYIYSDTQSLPVTHCGCTADGIYYKLGDSFVTNDCSQHCTCASQGILL
CEPYGCRAGESCMVANFTRGCFQDSPCLQNPCHNDGRCEEQGATFICHCDFGYGGEFCTE
PQDITTRKKIEASSLVAILPGVLVMVLVPVLLPRVYVYMATRTTMGRRRMKRKEKKLLRQ
SRLRLEDADVPEPTFKATEF
NT seq 16263 nt   +upstreamnt  +downstreamnt
atggctctgccagtttggaccctgatgctgctggtgggggctgcctggggccaggaacaa
gtgcctgcgtggagaccgaactctccagacctggggccgatggtgcacacttcgagggag
gattccattctctccaagtgtgactttgaagacaattccagacctttctgtgactggtct
caaatgtctgcagatgatggggactggattcggactactggaccctccctgacgggcact
tctggcccccctggggggtaccccaatggagaggggtattacctgcacatggatcccaag
accttccctcagggcggagtggcacgcctgcgtagccctgacatatgggagcaaggcccc
ctttgcgtccattttgctttccacatgttcgggctgtcatggggcgcccagctcagactg
ctgctgctcaggggccggaagcacctccggccctatgtactctggaaacatgtgaacacc
cagagtccctcttggatgcccaccactgtcactgtaccagcagatcatgatataccaagc
tggctgatgtttgaaggcatgagaggaaacaccgcctacctggacatctctttggatggc
ctctctatccagcggggtacctgcaatcaggtctgcatgtcccagatgtgcacctttgat
actctaaatgatctctgcggctggagctgggtcccaactgccactggggctaagtggacc
cagaagaagggaccaacagggaagcagggtgtggggcctgctgaagacttctctaaccct
ggtaatggctactacatgctcctggactctacgaatgcaaggccaggacagaaagctgtt
cttctgagtcccctgagccactccagaggctgtatgaccctgtctttccactacataatg
catggccagggacatgaagaaggcctttttgtttatgctacgtttttgggcaacatccgg
aaatatactctcttctcggggcatcctggacctgactggcaggctgtgtctgtcaattac
acaggacagggacagatacagttcatggtagtgggtatgtttggaaatataccagagcca
gcaatagctgtggatgccatcagcatagctccctgtggagagagctttccccagtgcgac
ttcgaagacagagtccatcctttctgcgactggaaccaggtgtatggagacatgggacac
tggagctggggaagtaaaagtgtacccaccctcattgcagggtccccaagagagttccca
tatggaggggagcattacattttcttcgattcagtgaagttatcccaggaggggcagtct
gccaggttggtgagtccaccattctgtgcccctggggacatctgtgtggagtttgcttac
cacatgtacggccttggcaaaggtaccacactcaagctcctgttgggaagtcctgcgggt
agttttcccattcctctgtggaaccgtgttgggtctcagagctctggctggatgaacagc
tctgtcaccatccctaagggatatcagcagcccatgcagttgtttattgaggccacccgg
ggcaccagcactgcctttgttgtcgctctgaacttcatcttgatctctcatggaccatgt
cgggtattgctgcagacagagattccttccagtcctctgcttccacctactggcccttct
gaatctactgttcctacgctccccatggagcagcccaccagccctacaaaagcaaccact
gttaccatagaaatacccaccactcccacggaagaggccaccatccccacagaaacaacc
actgtccccacagaagtgatcaatgtctctcctaaagagaccagtatcccccctgaggtg
accattcctacagaagttatcactgtatctcctgaagagatcatttcccccacagaggtg
acccctgtccccacagacgtaacagctgcctacgtggaagcgaccaatgcctctcctgaa
gagaccagtgtcccccctgaggtgaccatccttacagaagttaccactgtttctcctgaa
gagaccactgtccccacagaagttcctattgtcctcatagaagcaaccgcattccccact
ggagagaccactctctacacagaagtgcccactgtacccactgaagtgacaggtgttcac
acagaagtgaccaatgtctctcctgaagagaccagtgtccccactgaggagactatctct
acagaagttaccactgtttctcctgaagagaccactctccccacagaagtgcctactgtg
tccacagaagtgactaatgtctctcctgaagagaccagtgttcctcctgaggagaccatc
cttaccactctctacacagaagtgcccactgtacccactgaagtgacaggtgttcacaca
gaagtgaccaatgtctctcctgaagagaccagtgtccccactgaggagactatctctaca
gaagttaccactgtttctcctgaagagaccactctccccacagaagtgcctactgtgtcc
acagaagtgactaatgtctctcctgaagagaccagtgttcctcctgaggagaccatcctt
acagaaataaccactgtttctcctgaagagactgtttttcccatagaagggaccactctc
cccacagaagtgcttactgtccccatagaagtaaccacttttcccactggggagaccact
gttcccacagaagtgcccactgtctccacagaaatgacaggtgttcacacagaagtgacc
actgtgtttcctgaagagaccagcatccctacagaagtggccactgttcttcctgccagc
attcctcctgaggagaccaccaccccaacagaagtgaccactacccctcctgaagagacc
accatccctgcagaagtgaccactattcctcctgtcagcatcccttctgaggagaccacc
accccaacagaagtgaccactacccctcctgaagagaccaccatccctgcagaagtgacc
actgttcctcctgtcagcatcccttctgaggagaccaccaccccaacagaagtgaccact
acccctcctgaagagaccaccatccctgcagaagtgaccactgttcctcctgtcagcatc
ccttctgaggagaccaccattcctacagaagtaaccactgtccctcctgaagagaccacc
atccctgcagaagtgaccactacccctcctgaagagaccaccatccctacagaagtgacc
actgttcctcctgccagcatccctcctgaggagaccgcctccctgacagaagtgaccact
acccctcctgaggagaccaccaccccaacagaagtgaccactgtccctcctgaaaagacc
accatccctacagaagtgaccactgttcctcctgccagcatctttcctgaggaaaccact
gtccctcctgaagagaccaccattgcttctgaagagaccactgtctccactcaagagacc
actctccttacagagcaatctgctgtcactcaaacatccatagcatgcagaccaccctgt
ccaagtcctccactaatgcccatcggaccactcctttcaaagcctccaggtgtgtcaatg
ttcagcctggccccgactacaggtgtttctaccacagagagctgccctccaaatgcccac
attgaattgtgtgcatgcccagcatcctgtgagagccccaagcccagctgccagcccccc
tgcattcctggctgtgtctgtaaccctgggtttttgtttagtaataatcaatgtatcaat
gagtcttcctgcaattgtccctacaacaacaagtactataagcctggggaagaatggttc
actcccaattgcacagagcggtgccgctgcttgccgggtagcctgatggagtgccagatc
tctcagtgtgggacgcatacggtatgccagctgaagagtgaccagtaccagtgtgagccc
tatggtaaagccacttgcctggtctatggggaccttcattttgtcacctttgatgagagg
cacattggcttcacagggacatgtacctacatcttgacacaaacctgcagcaactccaca
gaccacttctttaggataacagcaaacaccgaagaacgtggagtagaaggtgtatcctgc
ctggacaaagttgtcatctctctgccagagactaccgttaccatgatcagtggcagacac
acattgattggggatcaggaagtcaccctcccagccatactttctgatgacacctatgtg
ggtctgagtgggagatttgtggagctgaggacaacatttggtttgcgtgtgagatgggat
ggtgaccagcagctttttgtgactgtgtccagtaccttctcgggcaaactctgtggtttc
tgtgggaactatgacggggacagcagcaacgacaacctgaagtcagatggcatgatgaca
cacgatgaggaggagctgaggctgagctggcaggtggaagaggatgaggacaaggattgg
gtctcttccaggtgtcagaagaagaagaatcccccatcttgtgacgctgctttggggagc
actatgtcgggacccaagttatgtggacagcttgtcaacccaagtggaccctttgaggca
tgcctgctccacctgaaggcctcatccttcctggataactgtgtgactgacatgtgtagc
ttccaaggtctccagcagaagctctgtgctcacatgtcagccatgacggccacctgccag
gatgccggctatcctgtgaagccctggagggaaccccagttctgccctttggtctgccct
aaaaatagcaggtactcactatgtgccaaaccatgcccggaaacctgccatcctatatct
actacccagcactgctcagacaagtgtgtggaaggctgcgagtgtgaccctggcttcatc
ctcagtggttctgagtgtgtcccttcatcccagtgtgggtgcaccagcttccaggggcgc
tacttcaagctacaggagcagtggtttaatccagactgcaaggagatctgcacttgtgaa
agccacaaccatattctctgcaagccctggaaatgtaaggctcaggaagcctgtagctat
aagaatggcgtcttaggctgtcatgcccaaggagcagccacctgcatggtgtctggtgac
ccccactacctgacgttcgatggggctttgcatcatttcatgggcacctgcacttatgta
ctgacccagccttgctggtctaaatctcaagagaacaacttcgtcgtgagcgccaccaac
gagatacatgatggcaacttggaagtctcctacgtcaaagctgtccatgtgcaggtcttt
gacctcaaaatctccatgttcaaaggtcaaaaggttgtgctgaacaaccaaagggtggtg
ctacccgtgtggccttcgcaaggacgggtgaccattaggttgagtggcatctttgtcctg
ctctacacgaactttgggcttcaagttcgatacgatggaaggcacctggtggaggtgaca
gtgccttcctcatacaccggctcactctgtgggctgtgtgggaactacaacaataacagt
atggatgacaatttgcgtgtagacatgaagccagcaggcaactcacttctgctgggagct
gcttggaaaatccttgaagcctctgaccctggctgctttctagtcgggggcaagccctcc
cgctgcgcggacagcgacatggatgatgtctggactaagaaatgtgccatcttgatgaac
cctcttgggcctttctccaattgccacgaggcggtgcccccgcaggccagcttctccagt
tgtgtgtatggccagtgtgagaccaacggagacaacctaaccctctgccactccctgcag
gcctatgcatctctgtgtgcccaggccggccaggtgactacctggcgcaacagcaccttc
tgccctatgaggtgcccacctaggagcagctacaacccatgtgccaactcctgcccagcc
acctgccttaccctgagcaccccaagagactgtccaacgctgccctgtgtagagggctgt
gaatgccagagtggccacatcctgagtggaaccacctgtgtgcccctcagacagtgtggc
tgcagtgaccaggacggctcctatcacctgttgggggagagctggtacacagagaagacc
tgcaccaccctctgcacatgctcagcccacagcaacatcacctgcagcccaacggcctgc
aaggccaaccacgtgtgtttgcgccaggaaggactgctacgctgcgctgcagagatggga
gagtgtcgcatctcagaggattcccagatcgtgagctttgatgatcatagccatcctatc
caagacacatgtacttacatcttggtcaaagtatgccaccccaacacgaacatgcctttc
ttcatgatcagtgccaagaccgacataaacaccaacggcaaaaacaagactttcggtgtc
tatcagctctacattgacatcttcaacttccacatcactcttcagaaagaccatttagtc
ctcataagcttgatcaatgactcaatagtcacccttcccaccaccacccacatcccagga
gtcagtgtcatgactgaagacgtctataccattgtcacaattaaggatgaaattcaagtc
aagtttgagagcaataatttcttagatgtcaaaatccctgcatcctctaatgggaaggtc
tgcggtgtgtgtggcaatttcaacggcgaagaagaggatgagctcatgacacccagtggt
gaactagcagaggatgagcaggagttcatgaatagctggaaagataagagcatggaccca
aattgccagaaaatcgaagggcagaacctccaagtggaacagcaggagatcatgaatgga
aaatgcaggcccattgactttgagaaagcccaggcaaactgccaaactgcccttcagggt
cctgcctgggcccattgttcctcccgggtacccatcaagcccttcttgctgaagtgtatg
aacagcttctgtgaattcagagagctcttccgtgctctttgtgattctctgcagtccttt
gaagatgcctgccagaaccaggggctcaagccacctatctggaggaacagcagcttctgc
cctctggagtgtccagctcacagtcactatacaaactgccttccctcctgtccaccttcc
tgcttggatccagacagccgctgtgagggctctggccacaaagtccccgccacctgcagg
gagggctgcatctgccaacctgactatgtgctgcttaacgacaagtgtgtgctcagatct
cattgtggctgcaaagatgctcagggtgtcttcatcccggcaggcaagacttggatatcc
gaagactgtacccagagctgtacctgcatgaaaggaagcatgaggtgctgggatttccag
tgtcccccagggacatactgcaagaacagcaatgatggcagcagtaactgtgtcaaaatc
tctctgcagtgcccagcccacagcaagttcacagactgccttcccccctgtcatccttcc
tgctctgaccccgacggccactgtgagggcatcagcaccaatgcccactctaactgcaaa
gagggctgcgtgtgtcaacctggctatgtgctgcgcaacgacaagtgtgtgctcagaatt
gagtgtggctgccaacatacccagggtggtttcatccctgcaggcaagagctggacttcc
agaggctgttcccagagctgtgactgcatggaaggggtcattcgatgccagaatttccag
tgtccctcggggacttactgccaggacattgaggatggcaccagcaactgtgccaatatc
actctgcagtgccccgcccacagcagcttcaccaactgccttccaccctgtcagccttcc
tgctcggacccagaaggccactgtgggggctccaccaccaaagccccctccgcctgccag
gagggctgtgtctgtgaacctgactatgtggtgcttaacaacaagtgtgtgcccagaatt
gagtgtggctgcaaagatgcccagggtgtcctcatccctgcagacaagatctggatcaac
aaaggctgcacacaaacctgtgcctgtgtgacagggaccatccactgcagggacttccag
tgtccctcagggacctactgcaaggacatcaaggatgacaccagtaactgcactgaaatc
actctgcagtgcccggaccacagcctctacacccactgccttccctcctgcctgccttcc
tgctctgacccagatggcctctgtagaggcaccagccccgaagccccctccacctgcaag
gagggctgcgtttgtgaacctgactatgtgctgagtaacgacaagtgtgtgctcagaatt
gagtgtggctgcaaagatgctcagggtgttctcatcccggcaggtaagacttggatcaac
aggggctgcacccagagctgttcttgcatgggaggggccatccagtgccagaatttcaag
tgtccctcagaggcttactgccaggacctggaggacggcaacagcaactgcaccagtatt
cctctccagtgcccggcccacagccactacaccaactgccttccaacctgtcagccttcc
tgctcggaccctgatggccactgtgagggttctagcaccaaagcgccctctgcctgcaag
gagggctgtgtctgtgaacctgactatgtgatgcttaacaacaagtgtgtgcccagaatt
gagtgtggctgcaaagacacccagggtgtcctcatccctgcagataagacctggatcaac
agaggctgtactcagagctgcacctgcaagggaggggccatccagtgccagaaatatcac
tgctcctcagggacttactgcaaggacatggaggatgacagcagtagctgtgccacaatc
actctgcagtgccccgcccacagccacttcaccaactgccttccaccctgtcagccttcc
tgcttggactcagaaggccactgtgagggctccaccaccaaagccccctccgcctgccag
gagggctgtgtctgcgaacctgactatgtggtgcttaacaacaagtgtgtgcccagaatt
gagtgtggctgcaaagatgcccagggtgtcctcatccctgcagataagacctggatcaac
agaggctgtactcagagctgcacctgcaagggaggggccatccagtgccagaaatttcag
tgtccctcagagacttactgcaaggacatcgaggacggcaacagtaactgcaccagaatc
tctctgcagtgcccagccaacagcaacttcaccagctgcctgccttcttgtcagccctcc
tgctctaatacggatgtccactgtgagggatccagccccaacgctctctcctcctgcagg
gagggctgtgtctgtcaatctggctacgtgttgcataatgacaagtgtatactcagaaat
cagtgtggctgcaaagatgcccagggtgctctcatcccagaaggcaagacctggatcacc
agcggctgtactcagagctgtaactgcacaggaggggccatccagtgccagaattttcag
tgtcccttgaagacttactgcaaggacctcaaggatggcagcagtaactgcaccaatatc
cctctgcagtgcccggcccatagccactacaccaactgccttccatcctgtccaccctcg
tgcttggaccccgagggcctctgtgagggcaccagccctaaagttccctccacctgcagg
gagggctgcatctgccaacctggctacctgatgcataaaaacaagtgtgtgctcagaatc
ttctgtggctgcaaaaacacccagggtgctttcatctcagcagacaagacgtggatctcc
aggggctgcacccagtcctgtacctgctcagcaggagccatccactgcagaaatttcaag
tgtccctccgggacctactgcaagaatggggataatggcagctctaactgcaccgaaatc
actctacaatgcccaaccaacagccaattcacagactgccttccctcctgtgtgccttct
tgttccaaccgctgtgaggtcaccagcccaagcgtcccctccagctgcagggagggatgt
ctttgcaaccatggctttgtgttcagtgaggacaaatgtgtgcccagaacacagtgcggc
tgtaaagatgcccggggtgccatcattccggcaggcaagacctggacctccaaaggctgt
acccagagctgtgcctgcgtggaaggcaatatccagtgccagaatttccagtgtccccca
gagacctactgcaaggacaacagtgaaggcagcagtacttgcaccaaaatcactctccag
tgcccggcccacacccagtacaccagctgccttccctcctgcctgccttcctgcttggac
ccagagggcctctgcaaagatatcagtcctaaagttccctccacctgcaaggagggctgc
gtgtgccaatctggctacgtgctgaacagtgacaagtgtgtgctcagggctgagtgtgac
tgcaaagacgcccagggtgctctcatcccggcaggcaagacctggacctccccaggctgt
acccagagctgtgcctgcatgggaggggctgttcagtgccagagttcccagtgtccccca
gggacttactgcaaggacaatgaagatggcaacagtaactgcgccaaaataactctgcag
tgcccagcccacagcctattcaccaactgccttccctcctgtctgccttcctgcttggac
ccggatggcctctgtaagggagccagtcccaaagtcccctcctcttgcaaggaaggctgc
atctgtcaatctggctacgtgctgagtaacaacaagtgcctgctcagaaatcgttgtggc
tgcaaagatgctcacggtgcgctcatcccagaagacaagacctgggtctccagaggctgc
acccagagctgtgtctgcacaggaggaagcatccagtgcctgagtttccagtgtccccct
ggggcatactgcaaggacaatgaagatggcagcagtaactgtgccagaatccctccgcaa
tgtccagccaacagccactacactgactgctttcccccctgtccaccttcttgctcggac
ccagagggccactgtgaagcctctggccccagagtcccctccacttgcagggaaggctgc
ctctgcaaccctggctttgtgctcgatagggacaagtgtgtgcccagagttgagtgtggc
tgcaaagatgcacagggtgctctcatcccgtcaggcaagacctggacctctccaggctgt
acccagagctgtgcctgcatgggaggggttgttcagtgccagagttcccagtgtcccccg
gggacttactgcaaggacaatgaagatggcaacagtaactgtgccaaaataactctgcag
tgccccacccacagcaactacaccgactgccttcccttctgtctcccttcctgcttggac
cccagtgccctctgtgggggcaccagccctaaaggcccctctacttgcaaggagggctgc
gtctgtcaacctggctacgtgctggataaagacaagtgtattcttaaaattgagtgtggc
tgcagagacacccagggcgctgtcattccggctggcaagacatggctctccacaggctgt
atccagagctgtgcctgcgtggaagggaccattcagtgccagaatttccagtgtcccccc
ggaacgtactgcaaccacaacaataactgtgctaaaatacctctgcagtgcccagctcac
agccacttcaccagctgccttccctcctgtccaccttcctgtgccaacctggatggcagc
tgtgagcagaccagccccaaagtcccttccacctgcaaggagggctgcctctgtcaacct
ggctacttcttgaataatggcaagtgtgtgctccaaactcactgcgactgcaaagatgct
gagggtggccttgttccggcaggcaagacctggacctccaaggactgtacccagagctgt
gcctgcacaggaggggctgttcagtgccagaatttccagtgtcccttggggacttactgc
aaagacagtggtgacggcagcagcaactgcaccaaaatccataagggagccatgggggac
ggtgtgctcatggctggagggatcagagctctgcagtgcccagctcacagccacttcacc
agctgccttccctcctgtccaccttcctgctccaacctggatggcagctgcgtggaatcc
aacttcaaagccccctcggtctgcaagaagggctgtatctgtcaacccggctacttgtta
aataacgataagtgtgtgctccgaattcagtgtggctgcaaggacacccaaggtggcctc
attcccgcaggtaggacctggatctccagtgactgtactaagagctgtagctgcatggga
ggcatcatccagtgcagggatttccagtgtcccccagggacttactgcaaggagagcaac
gatagcagcagaacctgtgccaaaatccctctgcagtgtcccgcccacagccactacaca
aactgcctccccgcatgttcacgttcctgtactgatctggatggccactgtgaggggacc
agtcccaaagtcccgtctccctgcaaggagggctgcctctgtcaacctggctatgtggtg
cataatcacaagtgtgtgctccaaattcactgtggctgcaaagacgcccagggtggcttt
gtcccggcaggcaagacctggatctccaggggctgcacccagagctgtgcctgcgtggga
ggggctgtccagtgtcacaacttcacctgccctacagggactcagtgccagaacagtagc
tgttccaaaatcactgtacagtgcccagcccacagccactacaccacctgccttccctca
tgtctaccatcctgctttgacccagaaggcctctgtggggatgccagcccaagagccccc
cccacctgcagggagggctgtgtctgtgaagctgactatgtgctacgtgaggacaagtgc
gtgctcagaactcagtgtggctgcaaagacgcccagggtgatctcatcccggcaaacaag
acctggcttaccagaggctgtgcccaaaagtgtacctgcaaaggagggaacattcattgc
tggaatttcaagtgtcccttggggactgaatgcaaggacagtgttgatggaggcagtaac
tgtaccaaaattgctctgcagtgcccagcccacagccatcacacctactgcctaccctcc
tgcatcccatcctgctccaacgtgaatgaccgctgtgagagcaccagcctccagaggccc
tctacctgcatcgaaggctgcctctgccactcgggctttgtgttcagtaaggacaagtgt
gtgcccagaactcagtgtggctgcaaagactcccagggtaccctcataccggcaggtaag
aactggattactacgggctgttcccagagatgtacctgcaccgggggacttgttcagtgc
cacgacttccagtgcccctcaggagccgagtgccaggacatcgaggacggcaacagtaac
tgtgttgaaatcactgtgcagtgcccggcccacagtcactactccaaatgccttccaccc
tgtcagccttcctgctcggaccctgatggccactgtgagggcaccagccccgaagccccc
tccacctgcgaggagggctgtgtctgtgaacctgactatgtgctgagtaatgacaagtgt
gtgcctagcagtgagtgtggctgcaaagacgcccatggcgttctcatcccggaaagcaag
acatgggtctccaggggatgtaccaagaactgcacctgcaaaggagggactgttcaatgt
cacgacttcagttgcccaacagggtcccgttgcctggacaataatgagggcaacagtaac
tgtgtcacctatgctctgaaatgcccggcccacagcctctataccaactgccttccctcc
tgtctcccttcctgctcggacccagagggcctctgtgggggcaccagccctgaagttccc
tccacctgcaaggagggctgcttctgtcaatctggctatgtgctgcataaaaataaatgt
atgcttagaattcactgtgactgcaaagacttccagggtagcctcattaagaccggccag
acatggatctcctctgggtgttccaagatctgtacatgcaagggagggttctttcagtgc
cagagttacaaatgcccctcggggacccagtgcgaggaaagcgaagatggcagcagtaac
tgtgtctccagcactatgaagtgcccagccaacagtctctacacccactgccttcccacc
tgtctaccttcctgctctaaccctgatggccgctgtgagggcaccagccacaaggccccc
tccacctgcagggagggctgtgtctgtcaacctggctacctgctcaataaggacacgtgt
gtgcacaaaaaccagtgtggctgtaaagatatcaggggcaacatcatcccggcaggcaac
acctggatctccagtgactgtacccagagctgtgcctgcacggatggagtcatccagtgc
cagaattttgtctgcccatcagggtcccactgccagtacaacgaggatggcagcagtgac
tgtgcagccaacaaactggaaagatgtaccatctttggggatccctattacctcacgttt
gatggcttcacttaccacttcctgggtcgtatgaactactatctcataaagacggtggac
aagctcccaagagggattgagcccctgatcatggagggacgtaacaaaatatcccccaaa
gggagttcaaccttgcatgaagtgaccaccatcgtctatggctataaaatccagctccaa
gaagaactagtggttttggtcaacgatgaaaaggtggcggtcccctacaatccaaacgag
caccttcgggtcatgctgcgggctcagcggctgcttctcgtcacagacttcgaaatggtg
ctggattttgatggaaaacacagtgcagtgatctccttgcctaccacataccgtgggctg
acacggggcctgtgtggaaactatgacagggaccagtccaatgaactcatgctgcccagt
ggagtactcacctcaaatgtccatgtctatggcaacagttgggaggtgaaggcgcagcat
gccttcttccgcttcccaagggccctaccagaagaagaggaaagagacgaagagcctgac
cttctccaatcagaatgcagccaagagcagactgcgcttatcagcagcacccaggcctgt
agggtgcttgtggacccccagggaccctttgctgcatgtcaccagatcatagccccagag
ccctttgagcagcgctgtatgttggatatgtgcactggctggaagaccaaagaagaagag
gaacttcgatgtcgtgtcctcagtggctatgccatcatttgccaggaggcaggcgccaac
atgactggttggcgggaccacacacactgtgccatgacatgtcctgccaatactgtgtac
cagcgctgcatgacaccctgcccggcgtcctgtgccaaatttgtgacccccaaggtctgt
gaaggcccctgcgtggaaggctgtgccagcctccccggctacatttacagtgacacacag
agcctcccagtgacacactgcggctgcaccgccgatggcatctattacaagctgggtgac
agctttgtaactaacgactgctcccagcactgtacctgtgcaagccaggggatcctgctg
tgtgagccctatggctgcagagctggggagtcctgcatggtggccaactttactcgaggc
tgcttccaggacagcccttgtctgcagaacccctgtcacaatgatggccggtgtgaggag
cagggggccaccttcatctgccactgtgacttcggttatggaggagaattctgcacagag
cctcaggatatcacaaccagaaaaaagatagaagcatccagcttagtggccatcctgccg
ggagtgcttgtgatggtgttagtccctgtcttactgcccagagtgtatgtttacatggca
acaagaacaaccatggggaggaggaggatgaagaggaaagagaagaaactgttgagacaa
agtagacttaggctggaggatgcagatgttccagagcctaccttcaaagccaccgagttc
tga

DBGET integrated database retrieval system