KEGG   Mus musculus (house mouse): 226409
Entry
226409            CDS       T01002                                 
Symbol
Zranb3, 4933425L19Rik, AH2, AI316834, C730006D09
Name
(RefSeq) zinc finger, RAN-binding domain containing 3
  KO
K25861  DNA annealing helicase and endonuclease ZRANB3 [EC:5.6.2.- 3.1.-.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    226409 (Zranb3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    226409 (Zranb3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     226409 (Zranb3)
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     226409 (Zranb3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    226409 (Zranb3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Nucleases
    226409 (Zranb3)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C HNH ResIII zf-RanBP Flavi_DEAD DEAD HNH_5
Other DBs
NCBI-GeneID: 226409
NCBI-ProteinID: NP_081954
MGI: 1918362
Ensembl: ENSMUSG00000036086
UniProt: Q6NZP1 Q8BUI4
Position
1:complement(127881916..128030799)
AA seq 1069 aa
MPTAGSKKKAPTPQISCLTSESYTQLDFLPDKLRTKLLPFQKDGIVFALRRDGRCMVADE
MGLGKTIQAIAIAYFYKEEWPLLIVVPSSLRYPWIEELEKWIPELEPEEINVVMNKTDIG
RIPGSRVTVLGYGLLTTDAETLLDALNTQNFRVVIVDESHYMKSRTAARSKILLPMVQKA
RRAILLTGTPALGRPEELFMQIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGAS
NLSELHQLLNDIMIRRLKSEVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPN
SGAMETVMGLITRMFKQTAIAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIE
SKSRYIRIDGSVPSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWD
PGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQAT
EDDKEKWGFLQFAEAWTPSDSFEELKDSVFTHFEKEKQHDIRSFFLPKLKKRQLETTCDD
PEAFKEKITVASDPRKMATSDSTADKNGCEPEAKRLKSLSTEDHSSALEEGPSLQARATS
MEVVHEVKPPLASPALPEKGWQCGFCTFLNNPGLPYCEMCENPRSRAAGRNHLQDNNKND
EDAAQESTSKSDQAGLECERQCPERLEAEQSANSKEEALEGGGEDRLPSQPEIGQLNNSG
TLPVRETFMFCASRNTDRIHLYTKDGKPMNCNFIPLDIKLDLWEDLPATFQLKQNRSLIL
RFVREWSSLTAMKQRVLRKSGQLFCSPLLASEEITKQQAKENNTRRYITKEDVAKASMNK
VKSDGGHIRLITKESMTQDSSLKKIDSACVPSLNPCPADLTVEPSPSKGYIQAVDKEGRP
LCLRCQHPTCQPEQTAKASAWDSRFCSLKCQEEFWIRSNNSYLRAQVFATEHGVCQHCGV
DAQELFLRMRDAPKSHRKSLLNAAWTAKLPLEQLNEMLRNPGEGHFWQVDHIRPVYEGGG
QCSLDNLQTLCTVCHKERTAQQAKERSQVRRLSLATKHGSDITRFLVKK
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgcctacagctggtagcaagaagaaggctcccacaccgcagatttcttgtttaacaagc
gaatcatatacacagctggattttttaccggacaagcttagaacaaaactgcttccgttc
caaaaagatggcatcgtttttgccctcagaagagatggcaggtgtatggtggctgatgaa
atgggtctaggaaagacaatccaggcgattgcaattgcttacttctacaaagaggagtgg
cccctgctgatagtcgtcccttcatctctaagatacccttggatagaagaactagaaaaa
tggatcccagagctagagccagaggaaatcaatgtcgtcatgaacaaaactgacattggg
agaatcccgggcagcagagtgacagttctgggctacggtctcttaaccacagatgcagag
actttgctggatgcactgaacacgcagaacttcagggtcgtgatagtggatgagtcacac
tacatgaagtccagaactgctgcccgcagcaagattctcctgcccatggtgcagaaggcc
aggagagccattcttcttacaggaaccccagctctgggaaggcctgaggagcttttcatg
cagattgaggctcttttcccacaaaaatttggaacttggattgagtatgctaaaagatac
tgcaatgcacatgtcagatactttggcaaaaggcgtcagtgggactgtagaggggcatca
aaccttagtgagcttcaccagctcctaaatgacataatgatcagaagactaaagagtgaa
gttttaagccagctgcccccgaaagtcagacagcgcattccctttgaccttcccccagca
gctgtcaaggaactgaatgccagctttgaagaatggcagaaactaatgagagctccaaat
tcaggtgccatggagacggttatggggttgataacacgcatgttcaaacagactgcaatt
gccaaggcaggtgcagtgaaggactatattaagatgctgcttcagaacgactcccttaaa
tttctggtctttgcgcaccatttaagtatgctccaggcttgcacagaagcagtcatcgaa
agcaagtctcgttacatcaggatagatggaagtgttccatcttcagaaagaattcatctg
gttaatcaatttcagaaggaccccgatactcgtgtggctatcctgagcattcaggctgct
ggccagggtttaacgtttactgctgcgagtcacgttgtctttgctgagttgtactgggac
cctggacatatcaaacaagcagaagaccgagctcaccgaatcggacagtgcagttctgtg
aatattcactaccttattgcaaatggtactctggacagcctaatgtgggcaatgctgaat
cgaaaggctcaggtcacagggagcacactgaatggcaggaaggagaaactccaggctacg
gaagatgacaaggagaagtggggttttctgcagtttgctgaagcatggaccccaagtgac
agttttgaagagctcaaggattctgtgtttactcactttgaaaaagagaaacagcatgat
attcgatcattcttcttaccaaaactgaaaaagagacagttagaaacgacctgtgatgac
ccagaggcattcaaggagaagattacagtggcctcggaccctagaaaaatggctacaagt
gatagcactgctgacaaaaatgggtgtgagcctgaagctaaaaggttgaagtccctgagc
accgaggaccacagcagtgccctggaggaaggaccgtccttgcaagccagagccacatcc
atggaagttgtccatgaggtcaagcccccattggcttctccagcccttcctgagaaggga
tggcagtgtggcttctgcacattcctcaacaacccaggccttccatactgtgagatgtgt
gagaaccctcggagcagagctgctggccgcaaccatcttcaggataacaacaaaaatgat
gaagacgctgctcaggaaagcacctccaaaagtgatcaagctggtttggagtgtgaaagg
caatgccctgaacggttggaagctgagcagtcggctaatagcaaggaagaggcattggaa
ggtggaggggaagacagactgccatctcagccagagattgggcagttgaataattcaggc
actctgccagtgcgtgagaccttcatgttttgtgcaagcagaaacaccgaccggatccac
ctctataccaaggatggaaagccaatgaactgcaattttattcctttggatataaagtta
gacctttgggaagacttaccagcaacctttcaactgaaacagaatcgctctctgattcta
aggttcgtccgagagtggagtagtctgactgccatgaagcagagagttctcaggaaaagt
ggtcagctgttctgcagcccactgctggcttcggaagagatcacaaagcaacaagccaag
gaaaataatactagaagatacatcactaaagaagatgttgccaaggcttccatgaataag
gtgaaaagtgatgggggccacatccgtctcatcaccaaggaatccatgacccaggactct
tctctaaaaaagattgatagcgcctgtgtcccatctctgaatccctgcccagcggatctc
actgttgagccatccccatccaaaggctacattcaggcggtggataaggaaggaaggcca
ctctgcctccgctgccagcatcccacctgccagcctgagcaaacagccaaagccagtgcc
tgggactcacggttctgctccctgaaatgtcaggaagaattctggatccgatccaataac
agttacctgagagcccaggtgtttgcaacagaacatggtgtgtgtcagcactgtggtgtg
gacgcacaggagctctttctgcggatgagagatgcccctaaaagtcacaggaagagtctc
ctcaatgctgcctggactgcaaaactcccactggagcagctaaatgagatgctgagaaac
ccaggagaaggccacttctggcaggtggatcacatcaggccagtgtatgagggaggtgga
cagtgctccctagacaacctgcagaccctctgcacagtgtgccacaaggagagaactgcc
cagcaagccaaggaaagaagtcaggtgagacgactctctctggcaacaaagcacggatca
gacatcacccggtttctggtgaagaagtaa

DBGET integrated database retrieval system