KEGG   Mus musculus (mouse): 226412
Entry
226412            CDS       T01002                                 

Gene name
R3hdm1, R3hdm
Definition
(RefSeq) R3H domain containing 1
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: SUZ R3H
Other DBs
NCBI-GeneID: 226412
NCBI-ProteinID: NP_001344411
MGI: 2448514
Ensembl: ENSMUSG00000056211
Vega: OTTMUSG00000049353
Position
1; 1 E3
AA seq 1135 aa
MRMSDIVIIKDETETMKDLEAEMRDTTRVENLIKSENYGKISAEKNEHCIDNNIDLQRPP
QSFGQTGKRSKSSSKLKLVRSLAVCEESPPPPAAEISQETQEKIQIQLTQSFEKEEKPSK
DETDKEKASDKLPRKMLSRDSSQEYTDSTGIDLHEFLVNTLKNNPRDRMMLLKLEQEILD
FIGNNESPRKKFPPMTSYHRMLLHRVAAYFGLDHNVDQSGKSVIVNKTSNTRIPDQKFNE
HIKDDRGEDFQKRYILKRDNSSFDKDDSQMRIRLKDDRRSKSIEEREEEYQRARDRIFSQ
DSLCSQENYIIDKRIQDEDTIGTQQRRQIFRVNKDASGRSTNSHQSSTENELKYSEPRPW
SSTDSDSSLRNLKPAVTKASSFSGISVLTRGDSSGSSKSIGRLSKTGSESSGSVGSSTGS
LSHTQQPLPGSALSQSSHGAPVIYPAASNHSSLSFDGGLSGQGASPSTSFLLLPLEATGI
PPGSILINPQTGQPFLNPDGSPVVYNPPMTQQPVRTQVPGPPQPPLPPPPPQQPAASHMF
SQPVGPLQSSSQPVQCSPAPYPSPLLPVSPTQQYSVDNLGAQFSHMSLARQPSADGSDPH
ATMFQSTVVLQSPQQSGYIVTTAPPHPPPPPPPPPPPPSLPPGQSVPTASFSASGHPVSQ
PVLQQQGFLPQPSPQMPACYCAPGHYHSSQPQYRPIPSVHHSSHLNQPLPQPAQHTGYQV
MPNQQQNYQGIVGVQSPQSQSLMGGQPNSTGPHIQGVVIPYPSVPSYQVSLPQGSQGIAH
QTYQQPVVFPNQSNQGSLPTTGMPVYYSVIPPGQQSNLSSAVGYLQHPGSEQVQFPRTTS
PCSSQQLQGHQCAAVPQQPPGGGMVMMQLNLPNNPQSRTHSPPQWKQNKHYCDHQRGQKC
MDFSNMDNIVQPSPQLSSPILSPVQSPAPAQLSTLKTIRPSGPPLSIMSQFARPFVPGQG
DARYPLLGQPLQYNPPTLLHGHIPHQQGQSGSRHGNRGRRQAKKAASTDLGAGEAVVGKV
LEITELPDGITRVEAEKLFGELFKIGAKIRWLRDPQSQPQLRRHALCCGSGDNTVNPEHS
KPSDLASTYTVLATFPSISAAQSALKKQIHSVNKFKLRMSKKHYDFHILERASSQ
NT seq 3408 nt   +upstreamnt  +downstreamnt
atgaggatgtctgatattgttattataaaagatgaaactgaaacaatgaaggatttggag
gcagaaatgagagatacaaccagagttgaaaatcttatcaaatcagaaaactatgggaag
atttcggcagagaagaatgaacattgtattgacaacaatattgatttgcagcggcccccg
cagtcatttggacagacaggaaaaaggtctaagtcaagctcaaagttaaagctagttcgg
agccttgcagtatgtgaagaatctccaccaccccctgcagcagagatatcacaggagacc
caggagaaaattcagatacagttaacacaatcatttgaaaaagaggaaaagccctcaaaa
gatgaaacagataaagaaaaagccagtgataagttacccagaaaaatgttatcaagagat
tccagccaagaatacactgattcaactggcatagatctacatgaatttttagtaaataca
ttaaaaaacaatcccagggacagaatgatgctgctgaaattggaacaagaaattttagat
ttcattggtaataatgagtccccacgtaagaagtttcccccgatgacatcttaccacagg
atgctgttacacagagtggctgcctactttggattagaccacaatgttgatcagagtggg
aagtctgtcatagtgaacaaaactagcaacacaagaatacctgatcagaaatttaatgaa
catataaaggatgatagaggtgaagactttcagaaacgatacatccttaagagagataac
tctagctttgacaaagatgatagccagatgagaatacgtttgaaagatgacagaagaagc
aaatctatagaagaaagagaagaagaataccagagagctagagaccgaatattttcccaa
gattccctgtgttcccaagaaaactacattattgacaaaagaatccaagatgaggacact
attggtacccagcagaggcgccagatatttagagttaataaagatgcttcaggccgatcg
acaaacagccatcagagcagcactgaaaatgagttgaaatactcagagccacgaccctgg
agcagcaccgattcagacagctccctcagaaacctgaaacccgctgtcaccaaagccagc
agctttagcggaatctcagtcctgacaagaggtgatagctctggaagcagcaaaagcata
ggcaggctttcaaaaacaggatctgagtcttcaggtagtgtagggtcctctacaggctct
ctttctcacacccagcagcctctcccaggttcagctcttagccagtcttctcatggcgca
cctgtcatctacccggcagccagcaatcacagttctctttcctttgatggtggcctcagt
ggtcaaggtgcatctcctagcactagcttccttttgcttcccttggaagcaactggcata
ccacctggcagtattctgatcaacccacaaacaggtcagcccttcttaaacccagatgga
agtccagttgtgtacaatcctcctatgactcaacagccagttcgaacccaagtgcctggt
cctccacagccacctctgccacccccaccacctcagcagccagcagccagtcacatgttc
tcacagcctgttggtcctctgcagtcctcttctcagcctgttcagtgctctccagccccc
tacccatccccgctcctgccagtctcacccacccagcagtactccgtggataaccttggc
gctcagttcagccatatgagtcttgcccgccagccatcagctgatggttctgaccctcat
gccaccatgttccagtccactgttgtactacagtctccacagcagtctggttacatcgtg
acgacagcacctccacatccgccaccaccacctccaccacctccccctcctccttcccta
ccacctgggcagtcagtccccactgccagtttctctgcctctgggcatcctgtcagccag
cctgtgctccagcagcaggggtttcttcctcagccctcaccacagatgccagcctgttac
tgtgctccaggccactatcactccagccaacctcagtaccgccctatcccttctgtccat
cacagttcacacctaaaccaaccactgccacagcctgcacagcacacaggttatcaagtt
atgcccaaccagcagcaaaactaccaaggaatagttggagttcagtcaccgcagagtcag
agcctcatgggaggccagccaaacagcactggacctcatatccaaggagtggtcatcccc
tacccctcagtgccatcatatcaggtttcactgcctcaaggttctcaaggaattgcccat
cagacttatcaacagcctgttgtgttccctaatcagtctaatcaaggatctctgcccaca
acaggaatgccagtctattacagtgtcattccacctggccaacaaagtaatttaagctct
gcagttggttacttacaacatccagggtcagaacaagtacagtttcctcgaaccacgtca
ccatgcagctctcaacagctccaaggccaccagtgtgcagctgtgccacagcagccacct
ggtggaggaatggtaatgatgcagctcaacctaccaaataacccacagtctcggacccac
tcacccccacagtggaaacagaacaagcactactgtgaccaccagagaggacagaagtgt
atggactttagcaacatggataatattgttcagcccagccctcagctcagcagccccatc
ctttctccagtgcagtcgccagcaccagctcagctgtccactctgaagaccatccgtccc
tcaggaccaccgctttccatcatgtcccagtttgctagaccttttgttcctggacaggga
gatgccaggtatccgctgcttggccagcccctgcagtacaaccctcctactcttctgcat
ggacacattccacatcaacagggtcagtctggcagcaggcatggaaaccgaggacgtaga
caagctaagaaagctgcatccacagaccttggagcaggagaagcagttgtcggcaaggtc
ttggaaatcacagaactaccagacggaataactcgagtggaagccgagaagctttttggg
gaactctttaaaattggcgccaagatccgatggctccgggacccccagtctcagcctcag
ctgcgtcgtcacgctctctgctgtggtagtggggataacactgtcaaccctgagcactct
aaacccagtgacctggcctctacgtacactgtcctagctacgttcccctccatttcagct
gcacagagtgcactgaagaagcagatccattcagtgaacaagtttaagctgagaatgagc
aagaagcactacgatttccacattttggaaagggcaagttctcagtaa

DBGET integrated database retrieval system