KEGG   Mus musculus (house mouse): 226414
Entry
226414            CDS       T01002                                 
Symbol
Dars, 5730439G15Rik, Dars1
Name
(RefSeq) aspartyl-tRNA synthetase
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    226414 (Dars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    226414 (Dars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    226414 (Dars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     226414 (Dars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   226414 (Dars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    226414 (Dars)
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d S-AdoMet_synt_N
Other DBs
NCBI-GeneID: 226414
NCBI-ProteinID: NP_803228
MGI: 2442544
Ensembl: ENSMUSG00000026356
UniProt: Q922B2
Position
1:complement(128291444..128345153)
AA seq 501 aa
MPSTNASRKGQEKPREIVDAAEDYAKERYGISSMIQSQEKPDRVLVRVKDLTVQKADDVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIIDVEGVV
RKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAIRPEVEGEEDGRATVNQDTRL
DNRVIDLRTSTSQAIFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVVEEIADTLVQIFKGLQERFQTEIQTVSKQFPCEPFKFLEPTLRLEYCEALAMLREAGV
EMDDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNSYDMFM
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF
LGLHNVRQTSMFPRDPKRLTP
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgcccagcaccaacgccagccgtaagggtcaggagaagccgcgggagatcgtggacgcg
gcggaagattatgctaaagagagatatgggatatcttctatgatacaatcacaagaaaag
ccagatagagttttggttcgagttaaggacctgacagttcaaaaagctgatgatgttgtt
tgggtccgtgcaagagttcatacaagcagagcaaaagggaagcagtgcttcttagtcctg
aggcagcagcagtttaatgtccaggctcttgtggcggtgggagaccatgcaagcaagcag
atggttaaatttgctgccaacatcaacaaagaaagtattattgacgtagaaggtgttgtg
aggaaagtcaatcagaaaattggaagctgtacccagcaggatgttgagttgcatgtccag
aagatttatgtgatcagcttggctgaacctcgcctgcccttgcagctggatgatgccatt
cggcctgaagtggaaggagaagaggacggaagagctacggttaaccaggatacaagatta
gacaacagagtcattgaccttaggacatcaactagtcaggccatcttccgtctccagtcc
ggcatctgccatctcttccgagaaactttaattaacaaaggttttgtggaaatccaaact
cctaaaataatttcagctgccagtgaaggaggagccaatgtttttactgtgtcctatttt
aaaaataatgcctaccttgctcagtctccacaattgtataagcagatgtgcatttgtgct
gattttgagaaggttttctgcattggaccagttttcagagctgaagactccaatacccat
agacatctgactgaatttgttggtttggatattgaaatggcctttaattatcattaccat
gaagttgtagaagagattgctgacactttggtgcaaatattcaaaggacttcaagaaagg
tttcagactgaaattcaaactgtgagtaaacagttcccatgtgagccgttcaaatttttg
gagccaactttaagactggagtattgcgaggctttggcaatgcttagagaagctggagtt
gaaatggacgatgaggaagatctaagtacaccaaatgaaaaactgttgggtcgtttggtg
aaggaaaagtatgatacagacttttatgttcttgataaatatccattggctgtaagacct
ttctataccatgcctgacccaagaaatccgaaacagtccaactcttacgatatgttcatg
agaggagaagaaatattgtctggagcacaaagaatccatgatcctcagttgcttacagag
agagctttacaccatggaattgatttggagaaaatcaaagcttacattgattccttccgc
tttggagctcctcctcatgctggtggtggcattgggctggaaagggtgacgatgctgttt
ttaggattgcataacgtacgccagacctcaatgttccctcgtgaccccaaacgactcacg
ccttaa

DBGET integrated database retrieval system